Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G033219-GRMZM2G143480
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192579
Function (paralog2):6,7-dimethyl-8-ribityllumazine synthase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.23112546330241
Log2 mRNA fold difference:0.44590118793538
Log2 TE fold difference:-0.19710288860569
Sequences
Protein sequence

MPAMATAPVKFSVATNSPCVQPSLPLRRTPAAISFPCRPWSAAMNSCTGLLRRSDVVAAA
GHQKLMGSLTTNEGLRFGVVVARFNEVVTNLLLQGALETFERYSVKEENITVVSVPGSFE
VPITAQKLGKSGKFDAILCIGAVIRGDTTHYDAVANSAASGVLNAGLSAGVPCVFGVLTC
EDMDQALNRAGGKAGNKGAEAALTAIEMASLFRHHLG*

MATAPVTSSMATNSTCVRLPSMPLRRAPAIVSFASRRTPWSTAMTSCTGLSRHSDVVAAA
GHQKLMGSLNNNEGLMFGVVVARFNEVVTNLLLQGALETFERYSVKAENITVVSVPGSFE
VPITAQKLGKSGKFDAILCIGAVIRGDTTHYDAVANSAASGVLNAGLSAGVPCVFGVLTC
EDMDQALNRAGGKAGNKGAEAALTAIEMASLFRHHLG*

Other information
Ka divergence:-0.0529988KaKs divergence:0.0149331
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):654Length 2 (bp):654Length divergence:0
MFE 1 (kcal):-218.3MFE 2 (kcal):-221.51MFE divergence0.007