Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G033478-GRMZM2G473310
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.29250598699168
Log2 mRNA fold difference:-0.60441728746358
Log2 TE fold difference:0.89372533193246
Sequences
Protein sequence

MDHDDTDFQSQNFQLAGEGSNKFSSGLRPFALPKLDIEDQLQGHLRFDNLIDTEAFFSVQ
GHGNSWIEVLSTGSSVVDFSSSAAESCSISKTNNVWSEATSTESVEMLLKSVGENETTGD
MDNNAHLKLSGMDSQIDQSSVHPKSSNSLPDSTVVPTEEDQSLSTHSRMTDDLDRSQISH
SIMTADLSNTESQLEHFRPFLMDKKAEQAVDSVGEKCIAGEKLSSSNNAPGSYPAIDNYF
GAGHDDRSLDKLNIPSTGVDSKNLNNEPFPELAPLQNIYTDSYHFKEDTTESEAGVTPQD
SKFRHINENKVEGGLQELQSLSCAGQSLGAVNLSSQASNETLLSESSDGLLEAITNPVKM
LHRSDDTCNKVNSTPQPSFSAVQHGAEGLENSVHRSNEFVVKEFSIGSNSLLSHQPEADP
KFFNPHPISSLSPKSKISDATCVPEETKNVGSNSINTCCTGDESKHVVLENRQYSVDNLK
SGDMGEKMSGEEIPAVSGNIDQMIENDHEEKAANATGTSKDKVDPSDSIALENFAADTFN
ASEDSDIPSLNHKRSFEEHESSALGVEPKNTNLLQSTSGLQEKISASVISSSSGITPTIV
TDNFDISEDKNGCSIGVSSVDSPALLAEKDLNMSTVNTEEPFKEGVKSALGDQHNGISSG
SGQGGEMPAVPMDSKIAVYSGTVSATEREKFKEQPNSLGCLTTGETQDKSDSMDPTTAST
LGGKVAVKIVKTPLNASDDLNAHMQDIVLNQGTDCSSGTVPSQGNEGSSLLEPGNGDGIC
TGVTCGSPSVISCAESCPQEGGHGSTALLHHTLCGQSEDPEDHGASVDGIQSSKQCNTRN
IESAPGSQETSAAGGDRSFSFEVGAPPNVAEKAHSPVWSPFPKYITSQSSKMATENTQAG
GSLKDTSDDSKKISTVESGKEQLSERKVTESSGGGLSDNCNIDDIIKGRSSPPRQHPIPE
CSVSSADLVNFPFTDPQHLQLRAQIFVYGALIQGTPPGEAYMVAAFGEPVGGGKPTWEAA
WRAAFERFQYKKSPHVSLETPTSSLIGSSVPEKASKGTAITTVPASKKVGKTVAPAHPAV
TLHSPTSDFPFGSSTFNLQRGTHLDFSQAVSPFAYNSHMRHPSPGVAPWYTQSPGPRPAA
WLIPPQNLIFDSSMQPVIPTNETAKGASSKNISVSHTVSSGVLPSLAPSIVSSPIAVVSD
GKQKAASSSKRGTTSQKSRKKKKASASSEQQPVIASPHLKMNMPSFTPAIKHTAGLTLCG
SKPVPNMGQIASEHNYQITGGMDSDQRIIFSEQIRGAVEQSAAQAKSASIDSVEAVKHKE
GIWSHLSTISRNKLPPKVEEKLTSVAAAAEAAVSVAKAAAEAAKMASEAALQAKMMADEA
LSSSISVMSMHHEADQYNVISSPPILSSSTPASSLKTKNKSHAPGSIISVAREAARKRVE
EASAAAKRAENLDAILKAAELAAEAVFRAGTIIGMGEPLPFTLRELLEAGPNGYWKSASA
RNKSGSCNDNPVTETLEVDAPANFNKSGRKRGRKPKYDQALPNSEPSSSCKELQSYGIHS
GVGHGVVEDVPITVSPNGNNVTSPINIIWNGIEKGSAVEVLSDKGGFGVAWFSAKVIDIN
GNNVFVNYDNHNGSGPHEEWVPLRQEGDKPPQIRLAHPATLSKFKTRKRLRETAGSCLWV
IGDHVDAWVNNSCWREGVISQNYETDETKYDVHFSVGGGGESLVVDAWSLRPSRVWKDGQ
WVEWSHARERKSKSNKGDSPPEKRQRIDLLQTGGNLSVLGEVGGSSKDNNINNAKNPEEL
KPLSLSQGEIVFNIGKSVVENKSDSLAFRRPGLQKEGSKVVYGVPKHGKKKKFMEVSKHY
DAGQSDKISEGNSSNRFVKHLMPQLPRPRENASKVDPIRGRRVGETRSRLPKPTKSHNVG
ASSVPGKDSLPMQMHVPNSGVSERSSSFAGSSTSTSNNEKPTSENNNPVLGVGLRTEVSS
GPELQTASTVPSSKPNVSTTNRAKRKYVPTVSNTNRGILKTSEKSSSDSAEPRRTTSDSA
EPRRSNRRIQPTSRLLEGLQSSLVISKVPGEKVHRSNYKSASSRGRTQAHG*

MDHDDTDFQSQNFQLAGVGSSKFPSGLRPFALPKLDIEDQLQGHLRFDNLIDSEAFFSVQ
GHENSWIEVLSTGSSVVDFSSSAAESCSISKTNNVWSEATSTESVEMLLKSVGGNETTGN
MDSNAHLQLIGMDSQTDQSSVHPKSSTSPTDSTVVPTEKDQSWSTHSRMTADLSNTESQL
EHFVPFLLDKKAAQAADSVAEKCLTGEKLSSSNNTPGSCPTVGNYFGAGHDDNSLDKFNV
PSAEVDSKKLNNESFPELAPLQNIYTDSYHFKKDIKESEAVVTPQDSKFCHINENKVEGG
LQELQNLSCAGQSLGAVNLSSPPSNETLLSKSSDGLLEAITNPVKMLHRSDDTCHKVNIT
LQPSFLAVQHGTEGLKSSVHRSNELVVKEFSIGSNSLISHQSEADPRNSNPHPVSSVSPK
SKITDATCVPEETNNTETNSTNTCYTYDESKHVVLEYNQGSVDKLKSGDMGEKATGEEIP
AVSGSIEQMIENYHEENATGTSNNKVGLSDSIAPENCAADTLNASEEPNSPSLNHERSFE
EHELPALGEEPKSTNLLLSTSGFQEKISASVISSSSGVMPTIVTDNVATSEDNNGCSIGV
SSVDSSVLLDEKDLRTSTVNNEEPFKEGTKSALGDQENDGISPGSEQGGEMPAVPMDSNI
AVYSDTVSATEKEKYKDHPNSLGSLTTGGTQDKSGNHPDALSLKCQTGRSSIHTDLIDPT
TAPMLGIPTGKVAEKIVKTPLNASDDLNAHMQDAVVAKHKTTPELAEDTASLGTGMVVFD
AYAGGVPTAAGTNRLRAVGRGWSAGHSRCLRWCTQPWKWLTKDIVLNHGTDCSPGTVTSQ
GKEGSSLLEPGNGICTGVTCGSPSVISCAESFPQGGGNGSNDLLDHTLCGQSEDPKDRGA
SADATQRSKQCCTRNMKSAPGSEETSAAGGDRSFSFETVTENLQAGSSLKDTSDDNLVNF
PFTEAQHLQLRAQIFVYGALM*

Other information
Ka divergence:-0.0408942KaKs divergence:-0.000807827
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):6276Length 2 (bp):2946Length divergence:-0.361
MFE 1 (kcal):-1918.31MFE 2 (kcal):-884.75MFE divergence-0.369