Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G033515-GRMZM2G432128
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100217128
Function (paralog2):hypothetical protein LOC100274592

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.74163643362575
Log2 mRNA fold difference:2.7120578556801
Log2 TE fold difference:-2.6254690074784
Sequences
Protein sequence

MAFEKIKVSNPIVEMDGDEMTRVFWQSIKDKLIFPFLDLDIKYYDLGILHRDATDDKVTV
EAAEATLKYNVAIKCATITPDETRVKEFNLKHMWKSPNGTIRNIINGTVFREPIICKNVP
RLVPGWTKPICIGRHAFGDQYRATDAVLKGPGKLKLVFEGKEEQIDLEVFNFTGAGGVAL
SMYNTDESIRAFAAASMTTAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEADWKSKFE
AAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDG
KTIEAEAAHGTVTRHFRVHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFALKLE
AACVGAVESGKMTKDLALLVHGSSKVTRSHYLNTEEFIDAVATELRSRLGAN*

MAFEKIKVSNPIVEMDGDEMTRVFWQSIKDKLILPFLDLDIKYYDLGILHREATDDKVTV
EAAEATLKYNVAIKCATITPDETRVKEFNLKHMWKSPNGTIRNIINGTVFREPIICKNVP
RLVPGWTKPICIGRHAFGDQYRATDAVLKGPGKLKLVFEGKEEQIDLEVFNFTGAGGVAL
SMYNTDESIRAFAEASMTTAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEADWKSKFE
AAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDG
KTIEAEAAHGTVTRHFRVHQKGGETSTNSIASIFAWTRGLAHRAKLDDNARLLDFALKLE
AACVETVESGKMTKDLAILVHGSSSVTRSHYLNTEEFIDAVATELRSRLGAN*

Other information
Ka divergence:0.145518KaKs divergence:-0.999628
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1239Length 2 (bp):1239Length divergence:0
MFE 1 (kcal):-411.06MFE 2 (kcal):-411.34MFE divergence0