Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G033526-GRMZM2G144730
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273990
Function (paralog2):hypothetical protein LOC100272999 (LOC100272999), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.45057396802553
Log2 mRNA fold difference:-1.3393229822617
Log2 TE fold difference:0.89241264228193
Sequences
Protein sequence

MAAAAEIGGFAAARVAVATLRPAAHPAPAAAPQQPRRAVAAQSLRTTATEALTADLAGTT
NGAVHARMNSKATSEITSQAVTANSRRKTKIVCTIGPSTNTREMIWKLAETGMNVARLNM
SHGDHQSHQKVIDLVKEYNAQNTDGNVIAIMLDTKGPEVRSGDVPEPIMLKEGQEFNFTI
KRGVSTEDTVSVNYDDFINDVEAGDILLVDGGMMSLAVKSKTTDTVKCKVVDGGELKSRR
HLNVRGKSATLPSITEKDWEDIKFGVENGVDFYAVSFVKDAKVIHELKDYLKSANADIHV
IPKIESADSIPNLQSIIAASDGAMVARGDLGAELPIEDVPLLQAEIVQTCRSMEKPVIVA
TNMLESMIDHPTPTRAEVSDIAIAVREGADAIMLSGETAHGKYPLKAVKVMHTVALRTES
SLYNPTTSPSLVASAQGLQNEDFSPSQLSKMFGSHATMMANTLRTPIIVFTQTGSMAVLL
SHYRPSSTLFAFTNEERVKQRLALYQGVIPIHMQFSDDAEETFSRAISSLLKAQYVKKGD
YVTLVQSGVTSIWREESTHHIQVRKVQV*

MAAAAEIGGFTAAALRPLAHPAPAAAPRRAVAAQSLRTTATETLTADLAASTANGAVHAQ
MYSEASSEIPSQAAIANSRRKTKIVCTIGPSTNTREMIWKLAETGMNVARLNMSHGDHQS
HQKVINLVKEYNAQNTDGNVIAIMLDTKGPEVRSGDVPEPIMLSEGQEFNFTIKRGVSTE
DTVSVNYDDFINDVEAGDILLVDGGMMSLAVKSKTADTVKCEVVDGGELKSRRHLNVRGK
SATLPSITEKDWEDIKFGVENGVDFYAVSFVKDAKVIHELKDYLKGVNADIHVIPKIESA
DSIPNLQSIIAASDGAMVARGDLGAELPIEDVPLLQAEIVQTCRNMEKPVIVATNMLESM
IDHPTPTRAEVSDIAIAVREGADAIMLSGETAHGKYPLKAVKVMHTVALRTESSIYNPTT
SPSVIASAQGLQNEEFSPSQLSKMFGSHATMMANTLRTPIIVFTQTGSMAVLLSHYRPSS
TIFAFTNEERVKLRLALYQGVIPIHMEFSDDAEETFSRAISSLLKAQYVKKGDYVTLVQS
GVTSIWREESTHNIQVRRAQV*

Other information
Ka divergence:0.267932KaKs divergence:0.250191
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1707Length 2 (bp):1686Length divergence:-0.006
MFE 1 (kcal):-565.93MFE 2 (kcal):-564.12MFE divergence-0.002