Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G033555-GRMZM2G034069
Species:maize
Duplication type:TD
Function (paralog1):dihydroflavonol-4-reductase
Function (paralog2):hypothetical protein LOC100192966

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.2985483776361
Log2 mRNA fold difference:-0.88457881449701
Log2 TE fold difference:-0.32774278018155
Sequences
Protein sequence

MDPVRKSVCVTGAGGFVASELVKLLLSRGQYAVRGTVRDPDADRETWECGTAFFLEVERS
SRFFIKKGASKNAHLKVLEGAEERLQLLKADLMDYDSIASAVAGCEGVFHVASPVLSHRP
SNPEVEVIAPAVIGTTNVLKACYEAKVRRVVVVSSCGAVYANPIYPKGKVFDEDCWSDED
YCRKKEDWYLVSKTLSEREALAFAAKTGLDVVTVCPSLVFGPLMQPTVNLSSEMILKYFK
DLETVENVLSNMVDIRDVADALLLTYEKPEASGRYICSSHAIKISDMINILKTMYPSYPY
PKNFVEDDVNSVYSSEKLQKLGWSFKPIEESLRDTVESYKAFGILN*

MEAVGKSVCVTGAGGFIASWLVKLLLCRGQYKVRGTVRDPGASKNAHLKVLEGAGERLQL
VKADLLDYSSVASAIAGCEGVFHVASPVPSGRSSNPEVEVIGPAVTGTTNVLKACYEAKV
GRVVVVSSCAAVYANPNYPKGKVFDEDCWSDEAYCRKNEDWYFVSKTLAEREAFAYAAKT
GLDVVTICPSLVFGPLMQPTVNSSSKIILKYFTGDRETVENILRNMVDVRDVADALLLAY
EKPEASGRYICSSHAIKVADMINILKTLYPSYPYPKNFVEDDDNSVYSSEKLQKLGWSFK
PIEESLRDTVESYKAFGILN*

Other information
Ka divergence:-0.560215KaKs divergence:-0.208376
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):1041Length 2 (bp):963Length divergence:-0.039
MFE 1 (kcal):-345.1MFE 2 (kcal):-326.9MFE divergence-0.027