Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G033570-GRMZM2G317584
Species:maize
Duplication type:WGD
Function (paralog1):ETHYLENE-INSENSITIVE3-like 1 protein
Function (paralog2):hypothetical protein LOC100279789

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.84969290321809
Log2 mRNA fold difference:-0.70117620324282
Log2 TE fold difference:-0.17223237657881
Sequences
Protein sequence

MMGGGLMMDQSVVFPGVHNFVDLLQQNGDKNLGFASLMPQTSSGDQCVMGEGDLVDPPPD
SFPDAVEDDSDDDVEDIEELERRMWRDRMKLKRLRELQQSRGKDPMASGGGLADGSSKPR
QSQEQARRKKMSRAQDGILKYMLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEK
VRFDRNGPAAIAKYQADNAVPGAENELASGAASPHSLQELQDTTLGSLLSALMQHCDPPQ
RRYPLEKGVPPPWWPTGDEEWWPELGIPKDQGPPPYKKPHDLKKAWKVSVLTAVIKHMSP
DIEKIRRLVRQSKCLQDKMTAKEISTWLAVVKQEEELYLKMHPGARPPASTGGIASAISF
NTTSSEYDVDIVDECKGDEAGNQKTAVTDPTSFNLGAAILSDKFLMPTPMKEETADVEFI
QKRNAPAPAEPELMLNNRVYTCNNVQCPHSDYSYGFLDRNARNSHQYTCKYNDPITQSAE
NKPLPAPPQPQAFQPAFSQANQAANNLDFSLPMDGQRSIAELMNMYDTNFMTSKTMSSSD
SVTIMERPNAMPQRIQMDEGFFGQGNGVFDDVNSMMQQQQQQAPPVVQQQQQQQFFIRDD
TPFMSQMGDITSTAEFRFGSGFNMSSTAAAADYPGAAQKNDGTNWFY*

MMGGGLLVDQSVVFPGVHNFVDLLQQNGDKNLGFGSLMPQTSSGDQCVMGEGDLVDPPPD
SFPDAGEDDSDDDVEDIEELERRMWRDRMKLKRLRELQQTRGKDSLASGAGLADGSSKPR
QSQEQARRKKMSRAQDGILKYMLKMMEVCRAQGFVYGIIPEKGKPVSGASDNLRAWWKEK
VRFDRNGPAAIAKYQADNAVPGAENELASGAASPHSLQELQDTTLGSLLSALMQHCEPPQ
RRYPLEKGVPPPWWPTGDEEWWPELGIPKDQGPPPYKKPHDLKKAWKVSVLTAVIKHMSP
DIEKIRRLVRQSKCLQDKMTAKEISTWLAVVKQEEELYQKLNPGARPPASTGGIASAISF
NTSSSEYDVDIIDECKGDEAGNQRTAVTDPTAFNLGAAILSDKFLVPTPMKEETADVEFI
QKRNAPAAAEPELMLNNRLYTCNNVQCPRSDYSYGFLDRNARNSHQYTCKHKDPTPQSTE
NKPPSAPPQPQAFQPAFSQPNQALNSLDFSLPMDGQRSIAELMNMYDNNFVPNKNPSSDS
VAVMERPNAMPQQRIQMDEGFFVQGNGAFDDVNNSMMQQQQQQAPVQQQQQFFIRDDTPF
VSQMGDIAASAPEFRFGPGFNMSSGVDYPGAAQRNDGTNWFY*

Other information
Ka divergence:0.219127KaKs divergence:0.155313
GC content 1 (%):61GC content 2 (%):62GC content divergence:0.008
Length 1 (bp):1944Length 2 (bp):1929Length divergence:-0.004
MFE 1 (kcal):-810.33MFE 2 (kcal):-775.51MFE divergence-0.022