Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G033634-GRMZM5G819999
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192798
Function (paralog2):hypothetical protein LOC100272585

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.4451646037445
Log2 mRNA fold difference:-0.80904077389772
Log2 TE fold difference:-0.57663572244584
Sequences
Protein sequence

MLLPLLRSHPLLHHAARLSSPRTRLLLRRDAIPLARSPPIRMAASSGSGASSPASAPPAA
VVHKSKIKFCPACGSPTKLAIPDGDEKMRAVCSSCGRVHYENPKMVVGCLVEHDNKVLLC
RRKIEPAYGLWTLPAGYLEVGESTAEGASRETLEEACADVEIVSPFAQLDIPLIGQSYII
FRARLKTPNFSPGPESLECALFALDDIPFDSLAFSSIIVTLRMYTEDVRSGSIKFHYCTI
NKRLGASPSDLRSFDIDNHIAV*

MLLPFLRSHPLLHHAARLSSPRTRLILRRDLLPLARSRPIRMAAHSGSGSGASSPAPAPP
AAVVQKSKIKFCPACGSPTKLAIPDGDEKMRAVCSSCGGVHYENPKMVVGCLVEHDNKVL
LCRRKIEPAYGLWTLPAGYLEVGESAAEGASRETLEEACADVEIISPFAQLDIPLIGQSY
IIFRARLKTPNFSPGAESLECALFALDDIPFDSLAFSSIVVTLRMYTEDVRSGNIKYHYC
IINKRLGASPSDLRSFDIDNHIAV*

Other information
Ka divergence:0.680171KaKs divergence:0.688652
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):789Length 2 (bp):795Length divergence:0.004
MFE 1 (kcal):-241.44MFE 2 (kcal):-232.8MFE divergence-0.018