Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G033876-GRMZM5G812289
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.58320443018733
Log2 mRNA fold difference:-1.7463627213915
Log2 TE fold difference:1.1521771906462
Sequences
Protein sequence

MKSNDVKPLVSGQSVSWSGKAGFQEISNVGTKRGGSSENSPKNSVPTLSSSKVLTDKPGG
TDAAAKLNPGVSALSNLQHVQSTHVTTNLKEQPCKSTGGTGCPELPTVKEEKSSSSSQSP
NNSQSISSEPSKDARSSTAASGGASKTSGSSSRSHRRANNGLVSGNLKEPSVGRSVSLDR
SLLQDKSSQTGTASEKGIDMPSDHGNNHRLIVRFPNPGRSPARSASAGSFDDPSVTGGRA
SSPVVADRHDQTERRVKVKTENSRPHLASDANAESWHSNDIKGATGSEEGDKSPCAILDD
DNSRTPDHSVKDAHASRAACSSYMNEKGVSETKVGTSFSPMNALIEIKYSEASHSLQAGD
DTAMNLLASVAGEISKSELASSPSTSVKKLVCEGVNTGKVKVESDMGPSHPGQADAKKVA
MGNEVKNDACLVPKEEQHQTAPSPELADSKAVKSSAKIEIHEGHANKCNSQHASIDSKGE
NRDGCTAHGKVEDGSTNKDGAMESAFGSQRSLVVSSKNSRLVLAGESSLSAADKQTQGLL
KSTNHKHLLSVSDNPGAFDRHDSMAGKLDLMAAEVKKADVVGNSSVLQNDTEKKEHVSPS
SADVPKLVPAASPVGVANGNNEMKESNGSSSESNSHVKSEGVNSQQSEQSAKQSSKKSSD
GVCGKEDHVLSDEEGSSLAAHTKSNATAKLDFDLNEGIPGDDGHQSETTASPVVCSSAIH
LTGLLPFTSPTTSGLPPAPITVAAPAKGPFVPPENLLRAKPEIGWKGSAATSAFRPAEPR
KILEMPAATRDIPVSHAAGKQSRPTLGFDLNVADDQALEEDFPQSSAQTTCSESGNTRSR
DGSSRSAGIELDLNRADEVADNGQFVPNASHRVEVPLFSTRSLPRVLSNAGANSSRDFDL
NSGPDLYDVGTEPAPRSLPSKNTSSIQFLPQVPVRMNSDAMSNNISPWLVSTSPCGPVAI
QSFLPSREQPYPLEAAPGAQRIIAPTADGGQFGGDPCRPPVISTSPAMVFHPPAYQYAGF
SFPPSVHLQTPAFSIGSATFNNSASAGVPYFPTLSSSLVGPAGALPSQHSRQYAINLAEG
SSSSVRDGNRKWESQGLDLNSGPGSIDLEGKDERMPLPVRQNLIPPLHGFVEDQGRIYQM
PVVGTKRKEPDGSWDSERSTYKQLPWQ*

MWFAHGDQATCHVARGRTVAEYLSKTLLRLRQRTTRLRMVMYHRSPQPNDAPTDDVGSWS
MVVANFITDDSVDGASDANADATANDTDGREIRVGDCALFRAVDVPPFIGLIRWIEKKED
GHPKLRVSWLYRPTDVKLNKGIQLSAAPNEIFYSFHQDEASAVSLLHPCKVAFLRKGVEL
PAGISSFVCWRVYDIDNKCLWWLTDKDYINERQEEVNRLLHRTRLEMRAALQSGGRSPKR
LNGPSASQQLKTASVGTQNGGLSKGKKRDRSEQGVDPAKRDRDRLLKVDDSEPGIFNLDD
IKSEIAKITEKDGLPNAEAVEKLVHLMQLDRTEQKIDLSGRVILADVIAATENPDCLGRF
VQSRGLPVLDSWLQEAHKGKSGDGSSPKEADKPIDELLLALLRALAKLPINLSALQSCSI
GKSVNHLRSHKNLEIQKKAKCLVENWKKRVDAEMKSNDVKPLVSGQSVSWSGKAGFQEIS
NAGTKRGGSSENSPKNPVPTLSSSKFLTDKPGGTDAEAKLNPGVSALSNSQHVQPTNVTT
NLKDQPCKSTGGTGPELPTVKEEKTSSSSQSPNNSQSISSEPSKDARSSTAASGGASKTS
ESSSRSHRKANNGLVSGNLKEASVGRSVSLDRSLLQDKSSQTGTASEKGPDMPLDHGNNH
RLIVRFPNPGRSPARSASAGSFDDPSVTGGRASSPMVVDRHDQTERKVKGKTENTRPHLA
SDANTESWHSNDGATGSEEGDKSPCAILDDDNSRTPDDSVKDTHASRVACSSHTNEKGVG
ETKVGTPFSPMNALIEIKYSEASHSQQAGDDTAMNLLASVAGEISKSELVSPASSPRSSS
VKKLARDSDNIGKVKVESDTGPSHPGQADAKKGAMGKEVKIDACLVAKEEQRQTMPSPEL
PDSKAVVSSAKIEIYEVEAKIANKCNSQHASIDSKGESQDACTAHGKVVDGSIDKDGAME
SALGSQCRLVVPSRNSRLVHAGESSLSAADKQAQGLLKSTNHKQLLSVSDNPGAFDRRDS
MAGKMDLLAAEVRKTDAVGNSNIVQNEAEKKEHACSSLPDVPKLVVAAASPVGVANVNKE
MKESKDSSSESNSHVKSEGVNSQQSEQSAMQSSKKSCDGVSGKEDEKEDHVLSDEGSSLA
AHTKSNATAKLDFDLNEGIPGDDGHQSEPTISPVVCSSAINLTGILPFTSPITTGLQPAS
ITVAAPAKGPFVPPENLLRAKPEIGWKGSAATSAFRPAEPRKILEIPAAARDIPVSHAAG
KQSRPTLGFDLNVADDQALEEDIPQSSAQTTCSESGNTRSRDGSSRSAGIELDLNRADEV
ADNGQFAPSASHRVEVPLLSTRSLHGVFSNAGMNSARDFDLNSGPGLDDLGTEPAPKSLP
SKSTSSIQFLPQVPVRMNSAAMSNISPWLASASPCPVAIQSFLSTREQPYPIEAAPGAQR
IIAPTADAGQFGGDPCRPPVVSTSPAMVFHQPAYQYPGFPFPPSVHLQTPAFSIGSATFN
NSASAGVPYFPTVSPSFVGPAGALTPQHLRQYAINLAEGSSSSGRDSNRKWESQGLDLNS
GPGSIDLEGKDERVPLPVRQNLIPPPHGFVEDQGRIYQMPVVGTKRKEPDGSWDSERSTY
KQLSWQ*

Other information
Ka divergence:0.10293KaKs divergence:-0.0374583
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):3504Length 2 (bp):4881Length divergence:0.164
MFE 1 (kcal):-1132.67MFE 2 (kcal):-1604.84MFE divergence0.172