Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G033952-GRMZM2G332522
Species:maize
Duplication type:TD
Function (paralog1):caffeoyl-CoA O-methyltransferase 1
Function (paralog2):LOC100286091

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.46430744614004
Log2 mRNA fold difference:-0.33108103065126
Log2 TE fold difference:0.87554112472124
Sequences
Protein sequence

MAPSGDTIALVHSGMDSSNKTLLKSEALYKYVLDTSVLPHEPECMRELRLVTDKHEWGFM
QSSPDEAQLLRMLIKLTGARRTLEVGVYTGYSLLATALALPDDGKVIAFDVNRDYYDIGR
PFIERAGVAGKVDFREGPALGNLDELLADEANLGAFDFAFVDADKPNYVNYHEQLLRLVR
VGGTIVYDNTLWCGTVAMPPETPMSDIDRRFSAAIRDLNVRLSADERVEVCQLAIADGVT
ICRRLV*

MAERTKPQAAPRATASTTTLHRTRTETNRSTMAAGGDDTTIAQVHSGIDSSNKTLLKSEA
LYKYVLDTSVLPHEPESMRELRLVTDKHEWGFMQSSPDEASLLRMLIKLSGARRTLEVGV
FTGYSLLATALALPADGKVIAFDVSREYYDIGRPFIERAGVAGKVDFREGPALEQLDELL
ADPANHGAFDFAFVDADKPNYVRYHEQLLRLVRVGGTVVYDNTLWAGTVALPPDAPLSDL
DRRFSAAIRELNVRLSQDPRVEVCQLAIADGVTICRRVV*

Other information
Ka divergence:0.186896KaKs divergence:0.177936
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):741Length 2 (bp):840Length divergence:0.063
MFE 1 (kcal):-339.7MFE 2 (kcal):-380.73MFE divergence0.057