Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G034096-GRMZM2G144818
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276291
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.6127539770012
Log2 mRNA fold difference:-0.65278631649879
Log2 TE fold difference:0
Sequences
Protein sequence

MQNSPTPLDSGTTAPAEEPTGRRSGMGAMAAARGQKALVALPQLVKSLRSDPVSGSARLR
HLPSLRRTFSLYDQINLIDSVPEDELRFQSYDDTGFKINNIKYEGSLLIVENKIMTWAPK
TFSEITAESLSIFKVVHPIPEILILGCGRHIQPVSPELRKFIRSTGMKLEAVDSRNAAST
YNILNEEGRPVAAAVLPYGVAC*

MAAAWGQKALGALPQLVKSLRSDPVSGSARHRRLPSLRRTFSLYDQINLIDSVPEDELRF
QSYDDTGFKINNVKYEGSVLIVENKIMTWAPKTFSEITPESLSIFKVVHPIPEIFILGCG
RHVQLVSPELRMFIRSTGMKLEAVDSRNAASTYNILNEEGRPVAAAVLPYGVTC*

Other information
Ka divergence:0.510752KaKs divergence:0.559992
GC content 1 (%):52GC content 2 (%):50GC content divergence:-0.02
Length 1 (bp):609Length 2 (bp):525Length divergence:-0.074
MFE 1 (kcal):-200.3MFE 2 (kcal):-177.67MFE divergence-0.06