Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G034302-GRMZM2G087901
Species:maize
Duplication type:WGD
Function (paralog1):sucrose transporter1
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.853653329181
Log2 mRNA fold difference:-3.6612370414901
Log2 TE fold difference:1.8268955707904
Sequences
Protein sequence

MARGDGELELSVGVRGTGGAAAAAADHVAPISLGRLILAGMVAGGVQYGWALQLSLLTPY
VQTLGLSHALTSFMWLCGPIAGLVVQPLVGLYSDRCTARWGRRRPFILIGCMLICLAVIV
VGFSSDIGAALGDTKEHCSLYHGPRWHAAIVYVLGFWLLDFSNNTVQGPARAMMADLCGH
HGPSAANSIFCSWMALGNILGYSSGSTNNWHKWFPFLMTNACCEACANLKGAFLVAVTRF
YVFQQVFLVMCLTITLFFAKEVPYRGNQNLPTKANGEVETEPSGPLAVLKGFKNLPTGMP
SVLLVTGLTWLSWFPFILYDTDWMGREIYHGDPKGSNAQISAFDEGVRVGSFGLLLNSIV
LGFSSFLIEPMCRKVGPRVVWVTSNFMVCVAMAATALISFWSLKDYHGYVQDAITASTSI
KAVCLVLFAFLGVPLAILYSVPFAVTAQLAATKGGGQGLCTGVLNISIVIPQVIIALGAG
PWDALFGKGNIPAFGVASGFALIGGVVGVFLLPKISKRQFRAVSAGGH*

MARGDGGQLAELSAGVRGAAAVVDHVAPISLGRLILAGMVAGGVQYGWALQLSLLTPYVQ
TLGLSHALTSFMWLCGPIAGLVVQPLVGLYSDRCTSRWGRRRPFILTGCMLICVAVIVVG
FSSDIGAALGDTKEHCSLYHGPRWHAAIVYVLGFWLLDFSNNTVQGPARAMMADLCDHHG
PSAANSIFCSWMALGNILGYSSGSTNNWHKWFPFLKTSACCEACANLKGAFLVAVVFLVL
CLTVTLIFAKEVPYRANENLPTTKAGGEVETEPTGPLAVLKGFKDLPPGMPSVLLVTAIT
WVYAIGHTDYLSWFPFILYDTDWMGREIYHGDPKGSNAQISAFNEGVRVGAFGLLLNSVI
LGFSSFLIEPMCRKVGPRVVWVTSNFMVCVAMAATALISFWSLRDYHGYVQDAITANASI
KAVCLVLFAFLGVPLAILYSVPFAVTAQLAATRGGGQGLCTGVLNISIVIPQVIIALGAG
PWDALFGKGNIPAFGVASAFALVGGVVGVFLLPKISKRQFRAVSAGGH*

Other information
Ka divergence:0.438469KaKs divergence:0.128571
GC content 1 (%):61GC content 2 (%):63GC content divergence:0.016
Length 1 (bp):1587Length 2 (bp):1587Length divergence:0
MFE 1 (kcal):-697.55MFE 2 (kcal):-710.34MFE divergence0.009