Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G034404-GRMZM2G092432
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):ACR8

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.3548147386656
Log2 mRNA fold difference:2.3494336064942
Log2 TE fold difference:0
Sequences
Protein sequence

MEWLDEYEKLVIRMNTPRVVIDNAVCPTATLVQVDSARKRGLLLEAVQVLADLDLSINKA
YISSDGRWFMDVFHVTDRLGRKLTDASVIAYIQQSLGTWVEPAAAAPPEGLTALELTGPG
RAGLLSEVFAVLADMQCGVADARAWAHRGRLACVAHLRADDPADGDGDGRVSRILARLSH
LLRGDGVVAPGAVAAVPASGVAHADRRLHQLMSADLHRAAPVPVPVPALAPAVSVQSWAE
RGYSVVTVQCGDRPKLLFDVACTLHDMDYVVFHGTVDTAAGRARQEFYIRRADGSPIRSE
AEREMLTHHLQAAIERRSLEGVRLELCAPDRAGLLSEVTRTFRENGLLVAQAEVSTKGDQ
ACNVFYVTDAAGKAPDRGAIDAVRERVGADRLVVSEEPRPPQQQLYPDASGPGSGGGGGL
GLVYLGNLVRRNLYNLGLIKSCS*

MEWLDEYEKLVVRMNTPRVVIDNAVCPTATLVQVDSARKRGLLLEAVQVLADLDLSINKA
YISSDGRWFMDVFHVTDRLGRKLTDDSVITYIQQSLGTWNEPARPAALEGLTALELTGPD
RTGLLSEVFAVLADLQCGVVDARAWTHRGRLACVAFLRGEGDADRVARILARLGHLVRGD
GEAPGAVAAVPAAAVAHVDRRLHQLMAADHNNSATPYPAAAVSVQSWAERGYSVVTVQCR
DRPKLLFDVVCALHCLDYVVFHGTVDTAAGDRARQEFYICSADGSPIRSEAERERLAQCL
QAAIDRRSLEGVRLELCTPDRPGLLSEVTRTFRENGLLVAHAEVSTKGGLASNVFYVTDA
DGKAAGQSAIEAVRARVGADCLVVGEEPRPPRVFPEAGPGDRDHGGGGLGLVYLGNLVKR
NLYNLGLIKSCS*

www.000webhost.com

Other information
Ka divergence:-0.212128KaKs divergence:0.0993377
GC content 1 (%):73GC content 2 (%):71GC content divergence:-0.014
Length 1 (bp):1332Length 2 (bp):1299Length divergence:-0.013
MFE 1 (kcal):-746MFE 2 (kcal):-700.3MFE divergence-0.032