Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G034563-GRMZM2G370425
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277405
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSGTTGGVVGVQTTAAAVPDLSLHISPPSPPPAGGVEALPEPRLLLGLGLGPGPGLELDD
DDDAVATKKVDDDDDAAAAAREHNLHAQRLRLQLHQPSQTAHGFKKSSSGTAAGGGRRSS
RAPRMRWTTALHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRTVKGS
TDRSCVAAAGHGGHAGDMVLLRRRGAGEGDGGYYDVPICNKNPVNTTVDPTFFNNNNSNI
TDRFALLH*

MITTTTTTMTAAPDLSLHISPPSPPEPRLLLGLELDDDTAAEAAAATKKADDAAAMREYN
NLQVQRRQLHQPSQTAGHGFKRGTSGSAAAGAGGRRSSRAPRMRWTTALHAHFVHAVELL
GGHERATPKSVLELMNVKDLTLAHVKSHLQMYRTVKQQGADRPCVAVAGHGHARDMVVLL
TTGVGEGDAGFVDDVSNSNSNSNNSVVVNNTVPAAFNNNHTDRLVCLCTCSRTPQSPGGR
EQQQQPAPAVDRRRDDAAAAAAACAWVVGRQVQHQRSCSEGVTKLQGLKVGDERVDRHHG
DDAIAAHRLVEDEARDDHAGSGGGFQQRRPSPNNTSGTVSSSEWLNQQHCSGVMSVRVLG
LPPATPPSLEMSLGRQGWQMDQQCGGEFEFDFEPSPPSAAKELTLLRCL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):64GC content 2 (%):65GC content divergence:0.008
Length 1 (bp):747Length 2 (bp):1230Length divergence:0.244
MFE 1 (kcal):-332.7MFE 2 (kcal):-587.3MFE divergence0.277