Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G034833-GRMZM2G433942
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100191906

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.7521392031402
Log2 mRNA fold difference:1.4709335277756
Log2 TE fold difference:0.23162233484835
Sequences
Protein sequence

MNEASASAGVGTGSGGEVPLVYKAWKGNNVFLLKGRFIFGPDARSLFVTMFLIVAPVSIF
CPLVAKELMDKFSYGLGLPVMIAAVLFTAYDLSLLLLTSGRDPGIIPRNAHPPEPEGFDD
NAEVGANQTPPVRLPRVKDVVVNGITVKIKYCDTCMLYRPPRCSHCSICNNCVERFDHHC
PWVGQCIGLRNYRFFYMFVFSTTLLCLYVFGFCWVFVVKIRNAEQITIWKAMTKTPASVA
LIIYTFIAVWFVGGLSVFHLYLMSTNQTTYENFRYRYDQRANPYNRGIMVNIKQILFTTI
PPSKNNFCGRVQQEHGLRPRPTNGFMSPNMGRAVGDIEMGRKPVAWDEPRMAAEIGDLGA
GLSNLLEDKDGRFRSASPDLSRDALAVGGGLEEEGSSAMNAGRSSWGVEAGR*

MNGASAGAGGEAPLVYKAWKGNNVFLLKGRFIFGPDARSLFITMFLIVAPVSIFCAFVAK
ELMDKFSYGLGLPVMIAAVLFTAYDLSLLLLTSGRDPGIIPRNAHPPEPEGFDGNAEVGA
NQTPPVRLPRVKDVVVNGITVKTKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQC
IGLRNYRFFYMFVFSTTLLCLYVFGFCWVFIIKIRNAEQITIWKAMTKTPASIALIIYTF
IAVWFVGGLSVFHLYLMSTNQTTYENFRYRYDQRDNPYNKGVMENIKEIFFTTIPPSKNN
FCGRVEQEHGLRPRPTNGFMSPNMGRAVGDIEMGRKPVAWDEPRMAAEIGDLGAGLSNLL
EDKDGRFRTTSPDLSRDALAVGGGLEEHGSSAMNPGRSSWGVEAGR*

Other information
Ka divergence:-0.327632KaKs divergence:-0.637755
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1239Length 2 (bp):1221Length divergence:-0.007
MFE 1 (kcal):-420.84MFE 2 (kcal):-406.84MFE divergence-0.017