Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G035325-GRMZM2G124502
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100193333

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.71906221062495
Log2 mRNA fold difference:-0.78712723327206
Log2 TE fold difference:0.028337951976179
Sequences
Protein sequence

MVSDQEIASCVESVLRGSAGGPGEASLAAVLQQAEATLGVDLSHKAGFIRDQMDLFFGPR
LQPQPPSKPQPAPSPPQAVVAPAAAVPQPHVLPQVQAHAQAQQMQPQQLAPLQPQLIFQT
IPQLSAMAPVPAVSAPPAVPAMAFYPPPPLAFRYTTGLAGAATGGTVSFQQPTPGAGGTA
SPTAAPQVAGDNKESASKRKRGGPGGLNKICAISPELQTIVGETAMSRTQIVKQLWAYIR
QNNLQDPDDKRKIICNDELRVVFETDTTDMFKMNKLLAKHITPLDPKDQLHEVKRMKAPT
VVPQPPPINQPSVVISDALAKFIGTDGTFPQDDALKYLWDYIKANQLEDVISGSILCDSK
LQELFGCESIPMSGLSEMLGHHFIKKT*

MVSDQEIASCVESVLRGSAGGPGEVSLTAVLQQAEATLGVDLSHKAGFIRDQMDLFFGPR
LQPQPLTTPQLAPPPPQAVVAPADAVPQPQPQHQVLPQAPPSAQQMQPQQLAPLQPQLMF
QTIHQLPAISPVPVVSAPPAMAFYPPPPLAFRYTTGLAGAATGGTVSFQQPAPGAGGTAS
PTAAPQVAGDNKESSSKRKRGGPGGLNKVCAISPELQTIVGETAMSRTQIVKQLWAYIRQ
NNLQDPDDKRKIICNDELRVVFETDNTDMFKMNKLLAKHITPLDPKGQLHEVKRMKAPTM
SPQPGRSIDQPSIVISDALAKFIGTDGTFPHDFALKYLWDYIKANQLEDVINESILCDSK
LQELFGCESIPMSGLSEMLGHHFIKKT*

Other information
Ka divergence:0.495733KaKs divergence:0.54415
GC content 1 (%):57GC content 2 (%):56GC content divergence:-0.009
Length 1 (bp):1164Length 2 (bp):1164Length divergence:0
MFE 1 (kcal):-402.04MFE 2 (kcal):-400.34MFE divergence-0.002