Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G035370-GRMZM2G124495
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):transfactor

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.8320436356777
Log2 mRNA fold difference:-1.5981500386955
Log2 TE fold difference:0
Sequences
Protein sequence

MLLIKLVYLLLRLISWFAVPVCFPARLFSPDTWSGDRWMMDAKKIKLHDYHLYGSQQLFP
AAGGLSFHPAAGLMSSLPQPPHAAWLHEDHHTTTPRSVLATHGSLQGSRCVGSDAAAFFA
AEELMMGMPRFDDCPLGGTEMTAFAKRPTTEDEQLHYRRPGPVDPLPLRDSAAVRTYYVR
PQQRDGATEAPPSLELPFQQGRRQQQQLFGNASTGRLLGGEPKAHSFTAHVATSTLLPAM
EAPAGMQQSPTENPLSRSCSTIGAPATHVGSGNVAAAAAPGHGAPSKTRIRWTQDLHERF
VDSVNQLGGADKATPKGILKLMNSDGLTIYHIKSHLQKYRIAKYMPASSTSEGNLIYRKQ
EKRAVGNDVQNLDPSTGMKITEALRVQLDVQRRLHEQLEIQRNLQLRIEVQGKKLQKMFE
EQMKASRTVMEPRQEEEDDDDDAFNDVHVQLLAAAARSDAGFQLNIS*

MNAKKIKLHDYHHCYGSPMCDPQLFPRAAAATTAGLSLHPGPGLVGSLPQRHGGGGGGWV
HEEHTATTPRAAQGQGGCVVGSDAAAFFAAEELMMGTARFDSPLGGTTTALQELTAFAKG
PPFGRPRPTTGGERERERLYPVDPLPLRDCAAVRTYYVRPQQRDGATEAPPSLELPFQRR
QQQQVHGLFGDPSTGRLLGGGEPQAHSFPAHTLKQVPASTFVPAMEAPPGMQSLMDNPLS
RSCSIIGAAATHAGSGNAAAPGQGAPSKTRIRWTQDLHERFVDCVNKLGGADKATPKGIL
KLMNSDGLTIYHIKSHLQKYRIAKYMPVSSTSEGKEKRAAAANDVQNLDPGTGMKITEAL
RVQLDVQRRLHEQLEIQRNLQLRIEAQGKKLQKMFEEQMKTSRTVMGPPQGADVAFIGAG
EQEEEVEVEDAFDDVQLLAAVSSASVGYRDGGFQSKIS*

Other information
Ka divergence:0.00695311KaKs divergence:-0.164978
GC content 1 (%):63GC content 2 (%):67GC content divergence:0.031
Length 1 (bp):1404Length 2 (bp):1377Length divergence:-0.01
MFE 1 (kcal):-631.3MFE 2 (kcal):-669.01MFE divergence0.029