Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G035377-GRMZM2G113245
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381534
Function (paralog2):hypothetical protein LOC100383044

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.1293198058433
Log2 mRNA fold difference:1.3458313773704
Log2 TE fold difference:-2.4850862812572
Sequences
Protein sequence

MRDPKPRRSQAARTLAARLRKHSTLLLLLLWFALSLALFLSATPPSAAPLRRSSSFLRSK
PRALAATTTDAAAVAPRVRIYVYDLPARFNRDWAAADARCSRHLFAAEVAVHEALLAYAG
RAARPEDADLFFVPVYVSCNFSTPNGFPSLSHARGLLADAVDLVRARMPYWNRSAGADHV
FVASHDFGACFHPMEDVAIADGIPEFLKRSILLQTFGVQGHHVCQEVEHVVIPPHVPPEV
AHELPEPEKAQRDIFAFFRGKMEVHPKNISGRFYSKKVRTELLQHYGRNRKFYLKRKRFD
NYRSEMARSLFCLCPLGWAPWSPRLVESVLLGCIPVIIADDIRLPFPPVLQWQEISLQVA
EKDIASLGMVLDHVVATNLTVIQKNLWDPVKRRALVFNRPMEAGDATWQVLRELEVLLDQ
SRRRRSVGSYSWRR*

MGDPRPRRSPAAPTLADKLRKHSTWLLLLLWFAVSLALFLSATPPAAAPLRRSSFLRSKP
RALAATGAAAAPPVRIYVYDLPARFNRDWAVADARCARHLFAAEVAVHEALLAYTGRAAR
PEDADLFFVPVYVSCNFSTPNGFPSLSHARGMLADAVDLVQAGMPYWNRSAGADHVFVAS
HDFGACFHPMEDVAIADGIPEFLKRSILLQTFGVQGHHTCQEVEHVVIPPHVPPEVEHEL
PEPEKAQRDIFAFFRGKMEVHPKNISGRFYSKKVRTELLQHYGRNRKFYLKRKRFDNYRS
EMARSLFCLCPLGWAPWSPRLVESVLLGCIPVIIADNIRMPFPSVLQWPEISLQVAEKDV
ANLEVVLDHVVATNLSVIQKNLWDPVKRKALVFNRPMEVGDATWQVLRELEVLLDQSQRR
RYGGSWRA*

Other information
Ka divergence:0.0760772KaKs divergence:0.195854
GC content 1 (%):62GC content 2 (%):60GC content divergence:-0.016
Length 1 (bp):1305Length 2 (bp):1287Length divergence:-0.007
MFE 1 (kcal):-534.04MFE 2 (kcal):-529.92MFE divergence-0.004