Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G035405-GRMZM2G089640
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.1367045110429
Log2 mRNA fold difference:-1.9007033443611
Log2 TE fold difference:0.76021290148436
Sequences
Protein sequence

MAKDLHGNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRR
ANRPQTVMPSSVLSSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLVKYVKAV
YHTRISVGMRFRMLFETEESSVRRYMGTITGICDLDSVRWPNSHWRSVKVGWDESTAGER
QPRVSLWEIEPLTTFPMYPSPFPLRLKRPWPTGLPSLHGGKDDDLANSLMWLRDTANPGF
QSLNFGGLGMSPWMQPRLDATLLGLQPDMYQAMATAAFQDATKQASPTMLQFQQPQNIAG
RASPLLSSQILQQAHHQFQQQPYLQNISESTIQAQGQSEFLKQQIQRSQSFNEQKPQMQH
QQESQQQQQPQCLPVPQHQQMQQQNMTNYQSISNALSPFSQLSPVSQSSPMALQTILPFS
QAQSFTDTNVGSLSPSNGNTMQNTLRPFSSEAVSHLSMPRPTAIPVADPWSSKRVAVESL
LPSRPQVSSQMEQLDPAPASIPHSSALAPLPGRGCLVDQDVNSDPQNHLLFGVSIDSQSL
LMQGGIPGLQNGNDSAAIPYSTSNFLSPSQNDFPLDHTLNSSGCLDDSGYVPPCSDNSDK
VNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPLRSGWQLVFVD
REEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMGKQGLELLSSAPARRLGSSCDDYVSR
QESRSLSTGIASVGSVELG*

MSHCLVRNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAAAHAASTNSRFTIFYN
PRASPSEFVIPLAKYVKAVYHTRISVGMRFRMLFETEESSVRRYMGTITGISDLDSVRWP
NSHWRSVKVGWDESTAGDRQPRVSLWEIEPLTTFPTYTSPFPLRLKRPWPTGLPSLHGGK
DDDLANSLMWLRDTTNPGFQSLNFGGLGMNSWMQPRLDTSLLGLQPDMYQAMATGAFQDP
TKQASPTMLQFQQPQNIAGRAAPLSSQILQQAHPQFQQQPYIQNISESTIQAQGQSEFLK
QQIQRSQSFNEQKPQLQPQQESQQQQQSQCLQAPQHQQIQQNIANYQSVSNALSAFSQLS
SASQSTPMALQTILPFSQAQSFTDTSASSLSPSNTNTMQNTLRPFSSEAVSHLSMPRPTA
IPVPDAWSSKRAAVESLLPSRPQDSSQMQQLDSTPASIPHSSALAPLPGRGCLVDQDANP
DPQNHLLFGVSIDSQSLLMEGGIHGLQNGNDSTAIPYSTSNFLSPSQNDFPLDHTLNSSG
CLDDSGYVPPCSDNSDQVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLE
GQLEDPLRSGWQLVFVDREEDVLLVGDDPWQ*

Other information
Ka divergence:0.234699KaKs divergence:0.395814
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):2220Length 2 (bp):1896Length divergence:-0.079
MFE 1 (kcal):-769.69MFE 2 (kcal):-613.03MFE divergence-0.113