Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G035552-GRMZM2G090842
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274815
Function (paralog2):hypothetical protein LOC100279260 (LOC100279260), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.18396308983387
Log2 mRNA fold difference:-2.569249277343
Log2 TE fold difference:2.7647298258642
Sequences
Protein sequence

MERYHPSEVYELFVRHMNTPRVVVDNGVCATATLVQVHSARKHGVLLEAVAALSDHGVCV
RKGYISSDDGRWFMDVFHVTDAAGRKVADADADALLARLESSLSADALPPRTPPAAAAGT
PTLLELVGADRPGLLSEVFAVLHDLRCDIADARAWTHGGRVAALVFVRDEDTGAPIDDAA
RVRRVESRLRHVLRGGALGARMVRADAAAVNMDRRLHQLLNEDGEAESRADQATAVAVQD
WGERGYSVLTVSCRDRPKLLFDVVCTLTDLDYVVYHGTFDTDGDHAQQEFYIRRLDGRPI
SSAAERRRVIQCLQAAIERRASEGVRLELRITDRRGLLAYVTRVFRENSLSVTHAEITTR
GDMAMNVFHVTDVAGRPADPKTIDEVIQRIGTESLRVDEERWPRLCLTEGDAGRGGAGIF
SLGSLVKKNLASLGLIRSCS*

MERYNPSEVYELFVRHMNNPRVVVDNGACATATLVQVHSARKHGVLLDAVAALSDHGVCV
RKGYISSDDGRWFMDVFHVVDAAGGKVADAGALLARLESSLSADALPPRPPPAAAGAGTP
TLLELVGADRPGLLSEVFAVLHDLRCGTVDARAWTHAGRVAALVFVRDEETGSPIDDAAR
VRRVESRLRHVLRGGALGARMVRADASAVNMDRRLHQLLNEDGEAGSRADRAESEAEAPT
PTAVAVQDWVERGYSVVTVSCRDRPKLLFDVVCTLTDLDYVVYHGTFHTDDDHARQEFYI
RRLDERPISSATERRRVIQCLEAAIERRASEGVRLELRITDRRGLLAYVTRVFRENSLSV
THAEITTRGRHGHERVPRHRRGRPTRGPQDHRRGDPEDRHGEPPGGRGAVAAPVLDGGRR
WPRRRRCGDLLAREPCQEEPGQSWPHKILLVRTRSMGGMCSMGSLCKYGMVHGLVCKWSR
GLNRRF*

Other information
Ka divergence:0.869258KaKs divergence:0.554075
GC content 1 (%):70GC content 2 (%):68GC content divergence:-0.014
Length 1 (bp):1323Length 2 (bp):1461Length divergence:0.05
MFE 1 (kcal):-679.5MFE 2 (kcal):-760.5MFE divergence0.056