Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G035601-AC197705.4
Species:maize
Duplication type:WGD
Function (paralog1):zinc finger, C3HC4 type family protein (LOC100281133), mRNA
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAADDAARSSRRMDLNLYLGLPRAPRARRPDLGFDLALGTPMLSSSSPSSSAASADAPPL
ETDPLHPPYSPSRADLMRPPTPAHEPYNPFAPEAHPPYVPPPPLPVAGALPVLADELEFG
FSDAHLGLVERLDRPSSSTASSSFRPDLAERYRHLMSLGGSRFFRPRRFRSDLPPLSSEL
PSLENDAAVQPPEPEEPVHDTVEENKVVAHGAVVGVSEDDGTEHGKSAPMFECNICFEMA
DEPVVTSCGHLFCWPCLYQWLHVHSSHKECPVCKGEVTEGNITPIYGRGNSGSEMEKKVA
EDGKASGPKIPPRPHGNRLESFRQQFHHLRPISRRLGEAHGFLSTWRRILDRHLANSMSR
FEGPPEPSVSETAQHASSLGRMTTRLRARRWQREAENPTSIDSSAPDSGQPVNNTFDLPR
RSSNPFPSEGMDLLRHIAFTGLEDSERFATAVSELRRIARASPYGASTSSNPPNPEPFGE
TQIATALAADQASNSSTMAVIQEDAAFTGSAGEPSNAGSSRPLRRRGSDALGSLDVDGGD
LHQNKRRRLN*

MASRAPIPPAPPHLRLHAASLFSQRLPLPRARAPRCRGGRSRLLSALPSPPPSPASRSQG
VSTAPIEREPPGLAPTPAPTPAQQPHQDPAIAAEVARLSAARERLRAAHTLHEKLRALDA
EPRVAAFFGEESSRGVLGVLEPREVLLLKCLVAAGQEHVLGHELDWYGGDGGHHEHHHRN
GVSGGSALRDALYSLAGLVGKWTSEGVVAAKERREEMEVLPRLLKFLDNVEEFYDCIGGI
IGHTRSYQIMVLELLSASKDRMHRPSKDKFVDFHVPSGLNLLKDKEYASQAALWGIEGLP
ELGEIYPIGGAGDRLGLVDSDTGESLPAALLPYCGRSLLEGLIRDLQAREFLHFKIFGGQ
CITPVAIMTSSVKDNHEHIIAICERLDWFGRGRDNFRLFEQPLVPVVNAKDGKWLISKSL
FPVGKPGGHGAIWKLAYDRGVLQWLQNCGRKGATVRQVSNVVAATDLTMMALAGIGLRCN
KKLGFASCERRPGATEGVNVLIEKQNLEGLWSYGITCIEYTEFEKYGIPEPTLTNSSQVS
FPANTNILYVDLQAVQEVGSRKNASCLPGMVLNLKKAVSYPNHLGFECSDMEVNLQHKVL
DSEVKASIQARKLDFNYKHGHKNSCRAELDCAPKPVLETGKHIDRIWNPTAAVAAGGRLE
CTMQNIADDFMNTFNYRCSKGIESELNTFIVYNERKRVTSSAKRKLKSEDRSLHQLLCIP
ELCSTPEGSLLDIMRNAHDLLSSCGIDIPMVQDNSEYMHSGPPFLIFLHPALGPFWDIIR
QKFVGGSVSKGSELQIEVAEFLWKDVELDGSFIILADNVMGSTKNSKNGEQILHYGSRCG
RCRLQSVKIVNEGINWTSPNNVYWKHDVERSESVKIILHGNAEFEAKDVVLKGNHVFEVP
DGHRMCIIQDRAGFVVKLDLIRDELMDSGTWHWKYAVDGVHFVGVRLSVAPGSRFQHRNR
SGTW*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):55GC content 2 (%):50GC content divergence:-0.048
Length 1 (bp):1653Length 2 (bp):2895Length divergence:0.273
MFE 1 (kcal):-620.73MFE 2 (kcal):-1040.97MFE divergence0.253