Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G035632-GRMZM2G112957
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.2352622829824
Log2 mRNA fold difference:1.2167085556659
Log2 TE fold difference:-2.1599403040697
Sequences
Protein sequence

MAAEALGFMARGANGGRAAELVTRDFLGGCAATGDARDASARNGTVPGRVPQQKHACPPT
PMDLNLFPIAAATKPCALTPSPSPSPAPAPASAGGAGAGATTTYRSVCTIEKVKTALERF
ERGRQQQPSHPHHNHPQQQQQHSGAGASPSSSTVTTSSVKRRGGGVEQGDDCDSPSGGGG
MVAAACPRCFLYVLISRSDPRCPRCESHVPAPAVSKKPRIDLNVGYLGT*

MAAEALGFMARGANGGRAAELVTRDFLGGCAATGDARDASARNGTVPGRVAQQKHACPAT
PMDLNLLTIKLFHTSLH*

Other information
Ka divergence:0.760715KaKs divergence:-0.999308
GC content 1 (%):73GC content 2 (%):65GC content divergence:-0.058
Length 1 (bp):690Length 2 (bp):234Length divergence:-0.494
MFE 1 (kcal):-361.41MFE 2 (kcal):-98.7MFE divergence-0.571