Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G035807-GRMZM2G092327
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100279527

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.022218981539264
Log2 mRNA fold difference:0.13633882098922
Log2 TE fold difference:-0.11457496627252
Sequences
Protein sequence

MRSSWADSVANAEESAPATAAANGSVANHSNSRPTRSSYVPPHLRGRSAGAAVGAQAGSV
APAQGGPLPLAAAQPSGQGAVVGGPRWAGIVNGGGGGSVGAPRQGYGGGGGGGGRGAWNS
RPGGWDRRDREPDPFAKAEAEEVDFDGQENTGINFDAYEDIPVETSGHDVPAPVNTFAEI
DLGDALNENIRRCKYVKPTPVQRYAIPISIAGRDLMACAQTGSGKTAAFCFPIISGILKS
PKPHQRSRSTRTACPLALILSPTRELSVQIHEEARKFAYQTGVRVVVAYGGAPITNQLRE
LERGVEILVATPGRLMDLLERARVSLQMIKYLALDEADRMLDMGFEPQIRKIVEGMDMPQ
RGERQTMLFSATFPKEIQRMAADFLADYIFLAVGRVGSSTDLIVQRVEFVLDSDKRSYLM
DLIHAQKANGTHGKHALTLVFVETKRGADALEDWLFRNGFPATSIHGDRTQQEREHALRS
FKSGATPILVATDVAARGLDIPHVAHVINFDLPNDIDDYVHRIGRTGRAGKSGLATAFFN
ESNTTLARPLSDLMKEANQEVPKWLDGYAARSAYGGGGGRNRRQGSGARFGGRDFRRDRG
SGGSYGGGGGGGGGYGGSSGYGGAYGGGGSSGYGGGQSTSSWD*

MRSSWADSVANAEESAPATAAANGSVATHSTSRPTRSSYVPPHLRGRSAGAAVEAQAGLV
APAQGGPLPLAAAQPSGQGAAVGGPRWAGIVNGGGGGGSIGAPRQGHGGGGGGRGAWNSR
PGGWDRRDREPDPFAKAEAEEIDFDGQENTGINFDAYEDIPVETSGHDVPAPVNTFAEID
LGDALNDNIRRCKYVKPTPVQRYAIPISIAGRDLMACAQTGSGKTAAFCFPIISGILKSP
KPHQRSRSTRTACPLALILSPTRELSVQIHEEARKFAYQTGVRVVVAYGGAPITNQLREL
ERGVEILVATPGRLMDLLERARVSLQMIKYLALDEADRMLDMGFEPQIRKIVEGMDMPQR
GERQTMLFSATFPKEIQRMAADFLADYIFLAVGRVGSSTDLIVQRVEFVLDSDKRSYLMD
LLHAQKANGTHGKHALTLVFVETKRGADALEDWLFRNGFPATSIHGDRTQQEREHALRSF
KSGATPILVATDVAARGLDIPHVAHVINFDLPNDIDDYVHRIGRTGRAGKSGLATAFFNE
SNTTLARPLSDLMKEANQEVPKWLEGYAARSAYGGGGGRNRRQGSSARFGGRDFRRDRGS
GGGYGGGSYGGGGGGGYGGSSGYGGAYGGGGSGGGGYGGGQSTSSWD*

Other information
Ka divergence:-0.268324KaKs divergence:-0.00629921
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):1932Length 2 (bp):1944Length divergence:0.003
MFE 1 (kcal):-743.53MFE 2 (kcal):-745.53MFE divergence0.001