Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G036086-GRMZM2G384972
Species:maize
Duplication type:WGD
Function (paralog1):peroxisomal biogenesis factor 11 family protein
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASSESPNTAPAAAAVASQPARDFLAHLEAYLARRDGVDKLLKISRYATRLALAAGPPLP
PGASARLKSFESSVGLSRKAFRLGKFVQSLNALLAHPHPPPSLALLAYGGEGVYYFVEQF
VWIAKAGLLPAHLLPRLQRLSAWAELLGYVGSILIKLEEVAKIESSIKKRLVKDCDKESE
AVKTMQGKLLLKRMSVVQDVADAVMALGDVTDGKGLLGSSTLMAAAGLLSALISTHKNWN
SC*

MNEKRFVVALSQTLVRTGTKPQSPMRPRQRFDRRIKHAIAASSVCGPAPVFYRLDAKVNA
GRHGLHRAPQSYAGRTPVRGRGRRSPTGPRLPRPPRRRRQAPQDLPLRHAPRTRRWGPGA
SARLKSFESSVVLSRKGFRLGKFVQSLRAHPHLPPALALLAYGSEGVYYFVEQFVWLAKA
GILPAHLLAKLLLKPEGTQVVDNTSYDEVKL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):64GC content 2 (%):63GC content divergence:-0.008
Length 1 (bp):729Length 2 (bp):636Length divergence:-0.068
MFE 1 (kcal):-300.5MFE 2 (kcal):-244.44MFE divergence-0.103