Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G036113-GRMZM2G163826
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384856
Function (paralog2):hypothetical protein LOC100304265

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.3515465316408
Log2 mRNA fold difference:-1.397945220066
Log2 TE fold difference:0.0017290615573022
Sequences
Protein sequence

MHEHTRAWAWEATVRKVQHPQPVGRRRVSPMSAADDYETASSSSSAAGDVCEHVHGYMER
GLPNGDFYTGQWRDGAPHGAGKYLWTDGCMYEGEWRHGKATGRGKFSWPSGATYEGEFKD
GFMDGSGTYTGAAGDTYRGSWSMNLKHGSGKKSYANGDEYDGEWRAGLQDGSGRYTWRNG
TEYTGQWCAGLIHGRGALVWSNGNRYDGGWEDGCPRGQGTFRWADGSVYVGRWTRDTPTG
IVQQKGVYYPSPAASSPTARDPRDVFARDLPGFMGARPDSPSPRKSRASSVRAANGRASS
ASGLSNSSGGDRKYEKICIWESDGDITCDIVDGPALGDEAGTARRSVRTDDGGDDRGLPP
PSPAPHVTQWVPPREVKRQGETIAKGHKHYELMLKLQLGIRCVEFICLQWPC*

MHDHTRARAWEATARKVQPVGRRRVSPMSAADDSETASSSSSSSSPAGDDADHVDRGLPN
GDFYTGQWRGGAPHGNGKYLWTDGCMYEGEWRHGKATGRGKFSWPSGATYEGEFKDGFMD
GSGTYTGAAGDTYRGSWSANLKHGDGNKSYANGDQYDGEWRAGLQDGAGRYTWRNGTEYT
GQWRAGLIHGRGALAWSNGNRYDGGWEDGSPRGQGTFRWADGSVYVGYWTRDAHTGIVQQ
KGVYYPSPAASSPTARDPRDVFARDLPGFLGAGPDTASPRKSRASSGTRAPNGRPSSVSG
LSNSSGGDRKYDKICIWESDGDITCDIVDGPALGDEAVTAQRSVRTDDGGGDDRGLPPPS
PAPHVTQWLPQRESKRQGETIAKGHKHYELMLNLQLGIRHAVGKQGPIVLDLKSSAFDPK
EKVWTKFPPEGSKCTPPHNSCDFRWKDYCPKVFRTLRKLFKVDAADYMLSLCGNEALREL
SSPGKSGSFFYLTNDDRYMIKTMKKSEVKMLLKMLPAYYNHVRAFENTLVTKFFGLHCVK
LAGANQKKVRFVIMGNLFCSEYPIHRRFDLKGSSLGRTTDKPQTEIDQYTTLKDLDLNFI
FRLKKQWFHEFQRQVDRDCEFLEQEKIMDYSLLVGVHFRENTEKLLTEGSIDYDIINNVP
TPRLSRGNTDRFLADPNRSPKTKLGANMPSRAELTARKSDCEPQLIGEPTGEYYDVILYF
GIIDILQDYDISKKLEHAYKSFQHDPASISAVDPRQYSRRFREFIYKAFQEEDG*

Other information
Ka divergence:-0.180251KaKs divergence:-0.208148
GC content 1 (%):69GC content 2 (%):59GC content divergence:-0.078
Length 1 (bp):1239Length 2 (bp):2325Length divergence:0.305
MFE 1 (kcal):-621.5MFE 2 (kcal):-957.22MFE divergence0.213