Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G036286-GRMZM2G016948
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100303941
Function (paralog2):hypothetical protein LOC100274617 (LOC100274617), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEPAERIESAGTALGKRPRSRVLPRTASMVTVPSAAKQGRQERGAGVPSSCSLPAACAGM
VAVPGGYYYCGTSFAAVETAAFLKACGLCKRHLGPGHDTFIYRGEVAFCSQECREKQIEY
DDLDERMEQTCSVTSMKEAPSVSGASGSDQSGSGGETVAAA*

MEPAERIESGTALGKRPRSRALPRTPSMVTVPSAAKQGRQERRAASLPAAGTGTGAAGAM
PVGYCYYYGGSFAAVETAAFLKACGRCSRRLGPGHDTFIYRGEVAFCSQECREKRIEYDE
RMEKTCCSLTSIKEAPSVSGASGSDQSGSGGETVAAA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):71GC content 2 (%):72GC content divergence:0.007
Length 1 (bp):486Length 2 (bp):474Length divergence:-0.013
MFE 1 (kcal):-260.8MFE 2 (kcal):-268MFE divergence0.014