Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G036590-GRMZM2G044684
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100217168
Function (paralog2):protein grpE

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.81385754710864
Log2 mRNA fold difference:1.1248930610421
Log2 TE fold difference:-0.28818377011837
Sequences
Protein sequence

MAALLRTAAALVPPPSSPLSAREPRGRCLRLACSRRAPVRQLRAWPLPTPHVFGRSGGRF
RRLSVTEAEEAAQTAAQEDPETEVTGESAADDSAGSTDETPSIIVTTLQSYRVALINDDD
AKAAEIESFLLSIEDEKNSLLNKITALDVELATQRERILRISADFDNFRKRTENEKLNMM
ENVQGELIESFLPVLDNFERAKMQIKVETEGEEKINNSYQSINKQFIEILNSLGVEDVET
VGKPFDPMLHEAIMREESSEYEEGIILQEFRKGFKLGERLLRPAMVKVSAGPGPENSGDD
DPTVVEDSVAPQKVEDVEEDGFDDGDAE*

MAALLRTAAALAPPPSSPPSAREPRGRCLRLACSRRAPVRPLRAWPLPTPHVFCLAGGRL
RRLGATEADEAAQTATQEDLETEVTGDSAADDSAGSTDETPSIIVTTLQSYREALINDDE
AKAAEIESFLLSIEDEKNSLLNKITALDAELATQRERILRISADFDNFRKRTENEKLNMM
ENVQGELIESFLPVLDNFERAKVQIKVETEGEEKINNSYQSIYKQFIEILNSLGVEDVET
VGKPFDPMLHEAIMREESSEFEEGIILQEFRKGFKLGERLLRPAMVKVSAGPGPEKFGDD
DPTAVEGSVAPQKVDEVEDDGFGAGDAE*

Other information
Ka divergence:-0.0708531KaKs divergence:-0.0623585
GC content 1 (%):49GC content 2 (%):51GC content divergence:0.02
Length 1 (bp):987Length 2 (bp):987Length divergence:0
MFE 1 (kcal):-342.14MFE 2 (kcal):-343MFE divergence0.001