Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G037189-GRMZM2G327692
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282334
Function (paralog2):hypothetical protein LOC100193790

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.2086321305167
Log2 mRNA fold difference:1.2966322754236
Log2 TE fold difference:0.88556328536956
Sequences
Protein sequence

MSTTTASSLNPNAPLFIPAAYRQVEDFSPEWWELVNTTAWFRDHCFRQRQLHEAACDDVA
ALLPDDLLDTNDLFYAPDVVHHQPATALLPGYDVLDVLAALSLSSPRAIRQPR*

MSAVAAMATSSLNPNAPLFIPAAYRQVEEFSPEWYELVNTTAWFRDHWFRQHQHHEAAFA
AAADAELDVAALLPDDSVDLLDTDDLFYAPDVHHPHNAKPALLPGYDLDMLRALSLSSPR
AAAAPSPSPLLRAQQQRHADRPAHHARGAARRVIIHQPR*

Other information
Ka divergence:-0.0585541KaKs divergence:0.353719
GC content 1 (%):69GC content 2 (%):72GC content divergence:0.021
Length 1 (bp):342Length 2 (bp):480Length divergence:0.168
MFE 1 (kcal):-143.1MFE 2 (kcal):-210.9MFE divergence0.192