Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G037368-GRMZM2G163848
Species:maize
Duplication type:WGD
Function (paralog1):IAA5 - auxin-responsive Aux/IAA family member
Function (paralog2):hypothetical protein LOC100193994

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.15733622470301
Log2 mRNA fold difference:0.069310587536426
Log2 TE fold difference:-0.22761696789181
Sequences
Protein sequence

MSPPLEPHDYIGLSAVAAAAPPTPTPTSSSSSSSSPAPRLTLRLGLPGSESPDRDRDCCE
DVAATLSLGPLPAAAAVSAKRAFPDPAQRPGASKASDAKQQASPAAPPAAKAQVVGWPPV
RNYRKNTLAAATASRSKAPAEEAASGAGPMYVKVSMDGAPYLRKVDIKMYSSYEDLSLAL
EKMFSCFIAGQSGLHKSSSKDRLTNGSKVDALKDQEYVLTYEDKDADWMLVGDLPWDYFT
SICRKLKIMRGSDAVGIAPRTVEQTGQNK*

MSPPLEPHDYIGLSAAAAAAPPTPTSSSSSSSSPAPRLTLRLGLPGSESPDRDRDRDRCE
DVAAALSLGPLPATPKAPAAVSAKRAFPDPAQRPGAAKASDDKQASPAAPPAAKAQVVGW
PPVRNYRKNTLAASASRSKAPAAEDAASAARPMYVKVSMDGAPYLRKVDIKMYSSYEDLS
VALQKMFSCFIAGQSGLHKSSSKDRLTNGSKVDALKDQEYVLTYEDKDADWMLVGDLPWD
YFTSICRKLKIMRGSDAVGIAPRTIEQTASGGSLLSVKISPVVVAASTLSPSAFWMETVL
KISGVNYKRFHSSDEEEKTSLPGRSDKGVASGMPESLATAREFIRSLEEGEVVTYLRKIL
VSRRRARIWLRSKVKCLLRVETDAGVGCASNPLVEAGVPTVEAPFQKAQAELYEKSNLKQ
ANVSIAIAYKNNLLMRGIQRSTESNIEDLLRCEKKISEEITSMKAQLVEKEKGKYFMRAS
ANLTHG*

Other information
Ka divergence:0.4059KaKs divergence:0.386721
GC content 1 (%):64GC content 2 (%):58GC content divergence:-0.049
Length 1 (bp):810Length 2 (bp):1461Length divergence:0.287
MFE 1 (kcal):-327.82MFE 2 (kcal):-567.2MFE divergence0.267