Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G037378-GRMZM5G839812
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382503
Function (paralog2):hypothetical protein LOC100279254

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.98668450722816
Log2 mRNA fold difference:-1.1697747036825
Log2 TE fold difference:0.24658236668438
Sequences
Protein sequence

MSKSDLDDLLLQAAGRTGKNQSRPSNPRWNSGGSGSDGFDDDDDDDSDAAPTYSRKKPSS
QVPLKKRHKPEKGGRRGGGGWNDEDDEDEDGRRSGGEDSDSAPSVGSDLYKDEDDKERLE
NMSELQRELILAERGTRLDDYKLKQRARASSSKTDKVGAPKDSSPPPPPSRMRSSTRTDK
SGSAAKSALDELRAKQRMRQQAPEARRITDLLPHSGSSIRRRAGSPPSDGSNDGNNRGRM
NDHGRIAGDGRDDEFDESPSRLDPLKFDDVKSITLRRSKLVKWFMEPFFDDLISGCFVRL
GIGKTKNGTPSYRLCIVRNVDASDPDRNYKLENYSTCKYLNVVWDSEANAARWQMTQVSD
SPPNEEEFKDWLQAAEKNGARIPTRQEVLDKKEAIQNAYNFVYSAATVQQMLQEKSAVRR
PINIAAEKDRLRSELEMALSRRNEHEAERIRTKLKNLQNRAQPVSKDNKAAKLEAMNRKN
RADNFKNASELKPVNTSLKAGEAGYDPFSRRWTRSRNYYASKPGGNNVEETANGSSSNVA
PSNEDTKSKAQTGTAATTAAQVAAADAGKLIDTNAPVDLGTESNMLHTFELPISLSALQE
FGGAKGLFDGYMARRQKIEATMGYKVPDNDGRRHALTLSVSDYKRRRGLL*

MSKSNLDDLLLQAAGRTGKNHSRPSNPRWNSGGSGSDGFDDDDSDAAPTYSRKKPSSQVP
LKKRHQPEQGGRRGSGGWKDEDDEDEDGRRSGGEDSDSAPSVGSDLYKDEDDKERLENMS
ELQREMILADRGTRLDDYKLKQRARASSSKTDKVGARKDSSPPPPPSRMRSSTRADKSGS
AAKSALDELRAKQRMRQQAPEARRFTDLLPRSGSPTRRRAGSPPSDGSNDGDGRGRPNDH
GRIADDSRDDEFDESPSRLDPLKFDDVKSITLRRSKLVKWFMEPFFDDLISGCFVRLGIG
QTKNGTPRYRLCIVRNVDASDPDRNYKLESYSTCKYLNVVWDSEANAARWQMTQVSDSPP
NEEEFKEWLQEAEKHGARIPTRQEVLDKKEAIQEAYNFVYSAATVQQMLREKSAVRRPIN
IAAEKDRLRSELEMALSRRNEAEAERIRVKLKNLQSRPQPVSKDNKAAKLEAMNRKNRAD
NFKNASELKPVNTSLKAGEAGYDPFSRRWTRSRNYYASKPGGDNAEETANKSSSIVEPSN
GDIKSKAQTGTSATTAAQVAAADAGKLTDTNAPVDLGTESNVMHTFELPISLSALQEFGG
AKGLFDGYMARRQKIEATMGYKVPDNDGRRHALTLSVSDYKRRRGLL*

Other information
Ka divergence:-0.00821114KaKs divergence:-0.0239144
GC content 1 (%):52GC content 2 (%):54GC content divergence:0.019
Length 1 (bp):1953Length 2 (bp):1944Length divergence:-0.002
MFE 1 (kcal):-697.86MFE 2 (kcal):-728.49MFE divergence0.021