Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G037379-GRMZM2G102404
Species:maize
Duplication type:WGD
Function (paralog1):acid phosphatase
Function (paralog2):acid phosphatase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.90587685604693
Log2 mRNA fold difference:0.65649082344207
Log2 TE fold difference:0.29793502437105
Sequences
Protein sequence

MESTSGEDAPKRNPLPSALVSNLESVLAARRPAAAEVSTAAAAGEAEASAPEDAPSGDGA
PARPIVLLTCAGGIRSAGLAALVDALVTGARCDVHVCAPESDKPACGYSITIRETITATS
VDFTGAKAFEISGTPVDCVSLALSGRLFPWSSPALVISGINTGPNCGFHSSAIAAAREAL
VYGVPSIAISLNWKKDETKDSDFKDAAQACLPLINAALDDIEKGTFLRGCLLNIGVPSAP
SAIKGFKLTKQSGYSPAQSWQAVSASRPSSATHFMGMHQSLGIQLAQLGKDASAAAAARR
VSGQRKAVEVESVATAGKQETREVVKKLFRAEFVERQHQGLDEDTDLRALENGFVSSHFS
LSLSFPPFKWLSIHPTLQVSVTPLNVHGQVEPEIQAPASDWLSAAVSLEKEKEAAPATAE
AHSAA*

MESTSGEDAPKRNPLPSALVSNLQSVLAARRPSAAEVSTAATASEAEAEAQEAEASDAPA
GDGTPARPIVLLTCAGGIRSAGLAALVDALVAAGRCDVHVCAPESDKQACGHSITIRETI
AASSVDFTGAKAFETSGTPVDCVSLALSGRLFPWSSPALVISGINTGSNCGYEMFHSSAI
AAAREALVYGVPSIAISLNWKKDETKDSDFKDAAQACLPLINAALDDIEKGTFLRGCLLN
IGVPSAPSANKGFKLTKQSGYSPAQSWEAVSTSRPLSATHFMGMHQSLGIQLAQLGKDAS
AAGAARRVSAQRKAVEVESVAAAGKQEIREVVKKLFRAEFVEKRYEGLDEDIDLRALENG
FISVTPLNVHGQVELEIGATASDWLSAAVSLDKEKVAASATADQQDVAAEEKEAPSAA*

Other information
Ka divergence:-0.0244054KaKs divergence:0.220217
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):1278Length 2 (bp):1257Length divergence:-0.008
MFE 1 (kcal):-482.28MFE 2 (kcal):-481.1MFE divergence-0.001