Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G037627-GRMZM2G015409
Species:maize
Duplication type:WGD
Function (paralog1):RING-H2 finger protein ATL5F
Function (paralog2):RING-H2 finger protein ATL5F

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MYTVHPHAAATSVTLNCTEAPLECLPLCPGGGKACSEYALPPPPPIPVIPRAPVADRHAP
VRLLLIISLLSAFLFLSLALSTLLLYRRRRLILRRRRRLAAAAAEGADDGGFGDEEEGGG
GGGVVHHVWYIRTVGLDEATIASIAAVEYRRGVGRGGDCAVCLGEFSDGELVRLLPRCAH
PFHAPCIDTWLRAHVNCPICRSPVVVIPSDLPVGAAEAEAGGDPSGEHHAHEEMSLSQSE
SETEGSEDYEDSSSTQSDGTTATAEENGRATPKPIRRSASMDSPLFLVAVPEAQDDVMQY
NCKLPNAREMKVFRVKEKEAAGTSSTSCQSGRFKIGRSMSSSGQGFFFSRNGRSSGAVLP
L*

MYTVRPHAAATVTLNCTEAPLDCLPLCPGGGDACFEYVLPPPPPIPVIPRAPVADRHAPV
RLILVISLLSIFLSLSLGLSTLLLYRRRRRLILRRRRSLAAATAEGPDDEEEGGGGGGVV
HHVWYIRTVGLDEATIASIAAVEYRRGVGRSGDCAVCLGEFSDGELVRLLPRCAHPFHAP
CIDTWLRAHVNCPICRSPVVVIPSDLPVDAAEAEAGGAQLGEHYVHEEMSLSQSESETEG
SEDSEASSASATQSEGTSTAEENGRDTPKPIRRSASMDSPLFAVALPEANDDVVRYNCKL
PNPREMKVFRAKEKEAAGISSSSCQSGRFKIGRSMSSSGQGFFFSRNGRSSGAVLPLSRW
EDSPN*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):65GC content 2 (%):64GC content divergence:-0.008
Length 1 (bp):1086Length 2 (bp):1098Length divergence:0.005
MFE 1 (kcal):-503.7MFE 2 (kcal):-484.5MFE divergence-0.019