Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G037644-GRMZM2G006121
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382561
Function (paralog2):hypothetical protein LOC100303806

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MLGVGLGVRLMVAVAPAPPVPAPPGKPPLPLCSSLRHRSSGWWFSNGDAHGRDSTAATTS
SRATRRKWWSDPDGSQEDYGSSSLEEDEYGYGYDYDYEDEAAFPGFGGAGEMFDEPWFSK
VFKTYGFMLPVMLASMFAVTGLKAFLMAMAIPLGQSAISFIIDAVWPRRKGNRDDRWRRP
VQEEEEEEEDFPRDATDFATGGRGRYSSSYYEGRRGRQSYQSSVSNDFADAASAAVGADD
STKSSSSGDGGGNKSSGGYGGWDELLDNNNNTAAAREAKRSSNSFSAGNTYYSTKSRPSA
TGEADADYTAAGGGGRAEQGVGAPPERMRMRRRRVPRTMGLGSTRYKQAPLLMRLLVAVF
PFLGSWFSVL*

MIVAAAAPAPPVPAPPGKPPFSLSSSSSSFSLRRRSFSLWFSNGNAHGRDSATATTSSRA
TRRWWWSDPGGSREDYGSSSLEEEDVYDYEDEAAFPRFGGAAELFDEPWFSKVYKTYGIL
LPLMLASMLAATGPKAFLMAMVIPLSQSAISFLLDAVWGRRKGNRDDRRRPFQEEDYPED
AAGFAAGGRGNGYRSRSSSSSNYYEGRRRTSNYQSSVSNNFAGAASTGVGADDNTKSSSS
GYGGWDELLDNDTAAQETKRRSSFSAGTTDRSTKSQPSATGEEDADYTATPSTRTRMRRR
RTPGTMGLGSTMYKQAPLVMRLLVAVFPFLGSWFRLL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):57GC content 2 (%):57GC content divergence:0
Length 1 (bp):1113Length 2 (bp):1014Length divergence:-0.047
MFE 1 (kcal):-449.22MFE 2 (kcal):-411.3MFE divergence-0.044