Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G037655-GRMZM2G138881
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100194013
Function (paralog2):ER lumen protein retaining receptor C28H8.4

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.20745444998829
Log2 mRNA fold difference:-0.0015089668178526
Log2 TE fold difference:0.2417698592618
Sequences
Protein sequence

MRGSSRRPVAVVMAWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAAHALG
IAVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTATLAATLFVIY
MIRFKLRSTYMLDKDNFALYYVVLPCAVLALLVHPSTSHNIVNRICWAFCVYLEAVSVLP
QLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDTRGGLLTALGYGLWPSMVLLS
EIVQTFILADFCYYYVKSVFGGQLVLRLPSGVV*

MRGSSRRPVAVVMAWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAAHALG
IAVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTAALAATLFVIY
MIRFKLRSTYMLDKDNFALYYVILPCALLALLVHPSTSHNIVNRICWAFCVYLEAVSVLP
QLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDTRGRLLTALGYGLWPSMVLLS
EIVQTFILADFCYYYVKSVFGGQLVLRLPSGVV*

Other information
Ka divergence:0.497312KaKs divergence:0.83579
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):822Length 2 (bp):822Length divergence:0
MFE 1 (kcal):-296.93MFE 2 (kcal):-295.83MFE divergence-0.002