Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G037875-GRMZM2G081571
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100382252
Function (paralog2):mo-molybdopterin cofactor sulfurase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.87267330207858
Log2 mRNA fold difference:-0.015107780842787
Log2 TE fold difference:-0.85070502694054
Sequences
Protein sequence

MERAASVISSLLGGGGGSGAQAATVKSVLVYPIKSCRGISVPQAPITATGFRWDRQWMLV
NSKGRACTQRVEPKLALVEVQMPPEAFAEDWHPTPDDHMVIRAPGMEPLKVPLSVECATI
SDVSVWEWTGAAYDEGAEAAEWFSTFLGCPTRLVRFNEDSETRLTDPDYARGYKTMFSDG
FPYLIVSQGSLDALNEILKEPIPINRFRPNILVEGCHPYAEDMWKSVKINKLTFQGVKLC
GRCKVPTINQDTGIPSPTEPTETLQTYRSGEVLLRSHKNKRQVYFGQNAVCKESLSANGE
GRIVKVGDPV*

MAMEKAASFLSSLLGGGGGEPAATVKSIFIYPIKSCRGLAVSQAPITSTGFRWDRQWVVV
NAKGRAYTQRVEPKLALVQVELPPEAFAENWQPTPDDHLVIRAPGMDTLKIPLITEHTTI
DDVSVWEWSGSAYDEGAEASEWFSTYFGKPSRLVRFKEASETRPTDPDYAQGYKIMFTDC
FPFLIASQGSLDALNEILKEPVPMNRFRPNILVDGCHPYSEDLWKTIKINNLTFLGVKLC
NRCKVPTINQEDGVPGTEPTETLQTFRSDQVLRPSHKNKRQVYFGQNLVCKESLSGEGKV
IKVGDPVYVVQAFASSNEAPA*

Other information
Ka divergence:-0.409608KaKs divergence:-0.370075
GC content 1 (%):53GC content 2 (%):51GC content divergence:-0.019
Length 1 (bp):933Length 2 (bp):966Length divergence:0.017
MFE 1 (kcal):-326.22MFE 2 (kcal):-337.69MFE divergence0.017