Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G038003-GRMZM2G361115
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0922293567984
Log2 mRNA fold difference:-1.5896097987005
Log2 TE fold difference:0.50757281084714
Sequences
Protein sequence

MGSWVRTITTPFRKACTIFGPQKDGGGGGKRSQQPNPATMVRHVDDAAERAKLHGEVMAC
AYEDVQVMWSMLDQTTRIGDLSGSS*

MGSWVRTITTPFRKACTIFGPHKDGGGKKQTQQRPNSAAVVQHVDAERAKLHGEVMACAY
DDVQVMWSMLDQARIRDLSASS*

Other information
Ka divergence:0.0191622KaKs divergence:0.349993
GC content 1 (%):63GC content 2 (%):63GC content divergence:0
Length 1 (bp):258Length 2 (bp):249Length divergence:-0.018
MFE 1 (kcal):-102.7MFE 2 (kcal):-101.3MFE divergence-0.007