Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G038279-GRMZM2G169911
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278876
Function (paralog2):hypothetical protein LOC100274203

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.75460052168736
Log2 mRNA fold difference:0.62497223040278
Log2 TE fold difference:0.060145144021257
Sequences
Protein sequence

MGRGRGRGKKLTTVRSHEDKGSSGEEVVPAKKRRGRPQKRFASKIDQAVDVENFVEKVDG
DQEEADDGKLKNSAAAGGNKRGRPLKEGSNIVVEDNNSIVPSSSDESTRTNGFRQIGSRR
KNKPRRAAEAGLECK*

MGRGRGRGKKLTTVRSHEDKGSSGEEVVPAKKRRGRPQKRFASKIDQADVENFVEQVDAD
QEEADDAKLKNSAAAGGTKRGRPLKEGSNIAVEDTNSTVRLSSDESTRTNGFRQIGSRRK
NKPRRASEAGLECK*

Other information
Ka divergence:0.516866KaKs divergence:0.923348
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):408Length 2 (bp):405Length divergence:-0.004
MFE 1 (kcal):-118.41MFE 2 (kcal):-123.2MFE divergence0.02