Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G038309-GRMZM2G472991
Species:maize
Duplication type:WGD
Function (paralog1):serine/threonine-protein kinase RIO2
Function (paralog2):hypothetical protein LOC100217272

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.82575936320968
Log2 mRNA fold difference:1.059531181328
Log2 TE fold difference:-0.23980078132792
Sequences
Protein sequence

MKLDVNALRYLAKDDFRVLTAVEMGMRNHEIVPVELIDRIARLKHGGTYKVLRNLLRNKL
VHHGATKYDGYRLTYLGYDFLAIKTLVNRGVFASVGRQIGVGKESDIFEVATDDGTVLAM
KLHRLGRTSFRAVKSKRDYLRHRRSFNWLYLSRLAALKEFAFMKALGDHGFPVPTAVDCN
RHCVIMSLVQGYPLVQVKKLQNPDDVFDSILGLIVRLAEHGLIHCDFNEFNIMIDDDEKI
TVIDFPQMVSVSHRNAQMFFDRDIECIYKFFNKRFNLRSVKNEEQAGSENDDEGNSRPSF
LSVEKGAGSLDKELAASGFTRKEKVDMDKYIEEVVEGHDSSSDDDNDEDSSDEPDCDLTP
SDSDAPGTFSEEHGTSCSGENRLEIPPSDGNGVVMAPLESGIKTFSMEDDDNDDGSSEDA
DEEEDAELTKQLNKQRRKAIAAAHGRRRPTSSRNAYKDKGKGTMNSKMQRQACNW*

MAARTLVARAVAFAVAPMVSLAGSQISSVALPRTRTICIDFHLLELAATTGFGEEGDAGC
GTASLASLCLAFALARADALRPGLDNLEARTGLPPFTSRSVRAVSVLISAKTGYRRRPTP
GAEASLSLRRRRSNSQQQKEDTMKLDVNALRYLAKDDFRVLTAVEMGMRNHEIVPAELVD
RIARLKHGGTYKVLRNLLKNKLVHHDATKYDGYRLTYLGYDFLAIKTLVNRGVFASVGRQ
IGVGKESDIFEVATEDGTVLAMKLHRLGRTSFRAVKSKRDYLRHRRSFNWLYLSRLAALK
EFAFMKALGDHGFPVPAAVDCNRHCVIMSLVQGYPLVQVKELQNPDDVFDTILGLIVRLA
EHGLIHCDFNEFNIMIDDDEKITVIDFPQMVSVSHRNAQMFFDRDIECIYKFFNKRFNLT
SEKNEEQAGSESDDEGNSRPSFLSVKKTAGSLDKELAASGYTRKEQVEMDKYIEEDAERH
DSSSDDDDDDDDNDKVGDAVSLVSLKIDQDDSAEPDCNLASRDSDVPGTFSEENETSCSS
EKRLESPSGDNGEAMKPLESEGKTLSQKDDNNDDDSSEDADEEEEDAELTKQLNKQRKKA
IAAASGRRRPVSSRNACKDKGKGTMNSKIQRQACQW*

Other information
Ka divergence:-0.220846KaKs divergence:-0.176196
GC content 1 (%):45GC content 2 (%):49GC content divergence:0.043
Length 1 (bp):1428Length 2 (bp):1911Length divergence:0.145
MFE 1 (kcal):-455.3MFE 2 (kcal):-648.24MFE divergence0.175