Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G038313-GRMZM2G151549
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193141
Function (paralog2):eukaryotic translation initiation factor 3 subunit 6

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.13821018633258
Log2 mRNA fold difference:0.62728211208549
Log2 TE fold difference:-0.49440424774951
Sequences
Protein sequence

MADHDLTALMAAQLDRHLVFPLLEFLQERQLYSRPEILEAKIRLLSGTNMVDYAMDIHKS
LHGTDDVPEDMVKRRSEVVSRLRSLDEAAAPLVAFLQNPQLVQELRPDKQYNIHMLQERY
QIGPDQIEALYQYAKFQFECGNYSWAAEYLYQYRALCTDTERSVSALWGKLAAEILMQNW
DVALEEFNRLKEIIDSKNFSSPLNQLQNRIWLMHWALFIFFNHENGRNGIIDLFFQDRYL
NAIQTNAHHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLQCLYVNYDFD
GAQQKLVECEQVILNDPFLGKRVEEGNFVTVPLRAEFLENARLFIFETYCRIHRCIDISM
LAQRLNMSYDEAELWIMNLVRSSKLDARIDSVSGTLIMTTNHINVHEQIIESMKGLNMRT
YMLAKNIVEPAQQAAR*

MSEHDLTALMAAQLDRHLVFPLLEFLQERQLYSESEILEAKIRLLSGTNMVDYAMDIHKS
LYGTDDVPEDMVKRRAEVVSRLRSLEEAAAPLVAFLQNPQLVQEFRPDKQYNIHMLQERY
QIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERNVSALWGKLAAEILMQNW
DVALEELNRLKEIIDSKNFSSPLNQLQNRIWLMHWALFIFFNHENGRNGIIDLFFQDRYL
NAIQTNAHHLIRYLATAVVVNKRRRNMLKELIKVIQQEHHSYKDPVTEFLECLYVNYDFD
GAQQKLIECEQVILNDPFLGKRIEEGNFVSVPLRDEFLENARLFIFETYCRIHRCIDISM
LAQKLNMSYDEAELWIMNLVRSSKLDARIDSVSGTLIMTTNHVNVHEQIVESLKGLNMRT
YMLAKNIVEPAQQATR*

Other information
Ka divergence:-0.2KaKs divergence:-0.57817
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):1311Length 2 (bp):1311Length divergence:0
MFE 1 (kcal):-463.9MFE 2 (kcal):-444.7MFE divergence-0.021