Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G038338-GRMZM2G040618
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193042
Function (paralog2):hypothetical protein LOC100384754

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.65852617049316
Log2 mRNA fold difference:0.60944924137319
Log2 TE fold difference:0.028627731083996
Sequences
Protein sequence

MASDDGLKTEAPNTRAPQAAACQLSVSPPIAMLAYLLHGPAAAIAAAPSAFLLRSLPPAK
TPFLSSLPRPVSPRRAAAAAFAFNPAAAAAPIVASLLEGPVLVWAGRLCLYYALLHVGLA
GSPRNPFLSHEIGGEDGAGDSDLGFSKWAEKLRGGASGEKDAQHKRKLTSKWKPTTKGTL
KRTYRVRSTDEGRRILKEIASVLSQDDHFVDASSHKGCQIRRESAHGESVCCYNVRALFD
ELPTPHLLLEITPFPAGQLTDNDYRKAERLEMVLRLSTSI*

MLAYLLHAPATAVAVAAAPCASYLRSLPPAKTPFLPSLPRPVSPRRAAAAFAFSPAAAAA
PIAASLLQGPVLVWAGRLCIYYALLHVGLAGSPRNPFLSHEIGGEDGAGDSDLGFSKWAE
KLRGGASGEKDAQHKGKLTSKWKPTTKGTLKRTYRVRSTDEGRRVLKEIASVLSQDDHFV
DASSHKGCQVRRESAHGESVCCYNVRALFDELPTPHLLLEITPFPAGQLTDNDYRKAERL
EMVLRLSASI*

Other information
Ka divergence:0.169811KaKs divergence:0.0993197
GC content 1 (%):61GC content 2 (%):62GC content divergence:0.008
Length 1 (bp):843Length 2 (bp):753Length divergence:-0.056
MFE 1 (kcal):-325.36MFE 2 (kcal):-289.28MFE divergence-0.059