Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G038374-GRMZM2G022987
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEFSKQGQAPVPNNIGSQPLPSSNVQSNQTERPSMFYPSSLPGDWSSQQMFSMGTSVPVS
SYCIVPMNQQPVQLGASRPEISRPLGPQPLLSRVSLRPPQQVLNIHTSLPGMAGSQHSPS
MAGRRSQQTIGSPKVQMLKSPSFQSSNKRSAQKEPPSKVQHQQLESVRSKFRESLVAALS
LDSDQQNKIQSDNVQSAGSIDNFKPGAGDAVQDLVATTSKDVCTTNSGVDTTVAPSRCEE
NEKLSSDLALEMTTSINDGMQQQSIQVSSEDDLLGQCMVADELLQGHGLSWVSDLDAGIS
ELNAEPNALKRPRTSNVESESKRIKSANELAMEKEKFNQRAEILAFRIEEELFKLFGGVN
KKYKEKGRSLLFNLKDKSNPELRERVLSGDIVPERLCSMTAEELASKELSEWRLAKAEEF
AQMVVLPTMEVDPRRLVRKTHKGEFQVEVEEPDGFSVEVELGSNVTNIPSKAVEDQTKSN
GTAGKVDVQEKDKASDSASHDEDGRTGNNGIPGDVECIDNEKADLMQELILDDVKDTVNL
PPIPSLDEFMQGLDSEPPFVDISVGTPQEDVNDSDELDTTMEPSDLPETEDNASAPEKTE
SKSDKSSAQVNSEHRLESPGHIAVQNSDLTEPRDGELSKSSPSPDKDEAKKTTVDNASNS
DSVHHNQAASLPMIRESIWEGAIQLTVSSLCNVVAIFKSGEKPSLKDWRSFIEIKGRVKL
SAFQEFVDQLPKSKSRAIMITELCWKEGSSESGRQNILQTIDAYISDERVGLAEPAEGIE
LYLCPPHGKTVEILSRHLPKEHQESLAVAGSSFIGVVVWRRPSISRAPTSHHNNRHDGSK
RQSILGKPQVTNPAARPSLPPNSYGAPPGFTSQREEEDVTDDAPPGFGPGVARDEDDLPE
FNFVKSSHHAANVTAHAYKGPWPHVPPPSARPAEQMRELVQKYGKRSSVQEAPRAWDDDD
DDIPEWNPTHQTIKQPPLPHAPQQLPLPPPPVQQMNAAYQQQYHIPSAVQPQVPITSLPH
AYLRTQQPQPGQAWQQPSNAWWPAQGVAAPAAQQPQYGVVPGSSGVQGYDSSNAGGMAWR
PR*

MEFSKQGQAPMPNNIGLQPLPSSNVQSNQTEYPSLFYPSSLPGDWSSHMGTSVPVSSYYI
VPMNQQSVQLGASRPEVSHPAQPLLSRVSLRPPQQVLNIQTSLPAMAGSQPSPSMAGRKS
QQKVASPKVQMLKSPSFQSSNKRSAQKELPSKVQHHQLESVRSKFRESLIAALSLDLDQQ
NRSQSPDNVQSDGSTDKFKPAAGDVVQDLAANTSKDVCTTNSGVATTVAPSRCEENEKLI
SGLASEMTMSINDDMQQPSNQVSSEDDLLGQCMVADELLQGHGLSWVSDHVAGISKPNAE
PNDLKRPQTSDVESESKRIKSANELAMDEEKFNQRAESLAFRIEEELFKLFRGVNKKYKE
KGRSLLFNLKDKSNPELRERVLSGDIAPERLCSMTAEELASKELSEWRLAKAEEFAQMVV
LPNMEVDPRRLVRKTHKGEFQVEVEEPDGFSVEVELGSNLTNIPSKTVEDQAKSNGTDGK
EDVQEKDKASDGTSQDEGGRTGNNDMPGDVQYIDNEKADLMQELILDDMKDTVNLPPIPS
LDEFMQGLDSEPPFVDLSVGTPQEDVNDSEEPGTTMEPEDLPETEDNASTPEKFESESDK
SSAQVNSEPKLESPGDTAVPNSDLTEPRDGELNKSSPSHGKGEAKKTTTDNASNPDSVHQ
DQAASIPMIRESIWEGAIQLNVSSLSNVVAIFKSGEKPSLKVWRSFVEIKGRVKLSAFQE
FVEQLPKSRSRAIMITELCWKEGSSESGRQHILQTIDAYISDGRVGLAEPAEGIELYLCP
SHGKTVEILSRHLPKEHQESLAVAGSSFIGVVVWRRPDIPRVPTSRHRHDGSKRQSILGK
PPVTNPAAARPSLPLNSYGAPPGFPNQRHQEEEDVADDAPPGFGPGVARDEDDLPEFNFV
NPTHHAANVTARAYMGRPHVPPPSARPAEQMRELVQKYGKRSSVQAPRTWDDDDDDIPEW
NPSQTIKQPPPLPHAPQQQPLPPPPVQQMDAYQQQYHITSAVQPQVPVASLTHAYLQIQQ
PGQAWQQPSNPWWPAQGVAAAAAQMTNIVHHQPQYGVVPGSSGVQGYDYSSASGMAWRPR
*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):3249Length 2 (bp):3243Length divergence:-0.001
MFE 1 (kcal):-1063.81MFE 2 (kcal):-1062.86MFE divergence0