Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G038606-GRMZM2G095114
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384520
Function (paralog2):hypothetical protein LOC100384520

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.26418253692522
Log2 mRNA fold difference:0.062464601811559
Log2 TE fold difference:-0.40286469461956
Sequences
Protein sequence

MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDKFWRMPECY
IRGNTIKYLRVPDEVIDKVQEETSKSRSDRKPPGVGRGRGRGDVGAKPGGRGIGRGQDDG
GRGSGGRGRGGVGAKGGNKVQVGAVVVAEAGRHKGECRFLRPVIVLHRLLRT*

MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDKFWRMPECY
IRGNTIKYLRVPDEVIDKVQEETSKSRSDRKPPGVGRGRGRGDVGAKPGGRGIGRGQDDG
GRGSGGRGRGGVGAKGGNKGGGRGRG*

Other information
Ka divergence:-1KaKs divergence:-0.999054
GC content 1 (%):53GC content 2 (%):55GC content divergence:0.019
Length 1 (bp):519Length 2 (bp):441Length divergence:-0.081
MFE 1 (kcal):-172.8MFE 2 (kcal):-157.1MFE divergence-0.048