Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G038636-GRMZM5G820822
Species:maize
Duplication type:WGD
Function (paralog1):Cysteine proteinase 2 Precursor (EC 3.4.22.-)
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.74046911048
Log2 mRNA fold difference:-5.4854985089187
Log2 TE fold difference:1.767003376369
Sequences
Protein sequence

MAPRRLLVLAVVALAATAAAANSGFADSNPIRPVTDRAASALESTVFAALGRTRDALRFA
RFAVRYGKSYESAAEVHKRFRIFSESLQLVRSTNRKGLSYRLGINRFADMSWEEFRATRL
GAAQNCSATLTGNHRMRAAAVALPETKDWREDGIVSPVKNQGHCGSCWTFSTTGALEAAY
TQATGKPISLSEQQLIDCGFAFNNFGCNGGLPSQAFEYIKYNGGLDTEESYPYQGVNGIC
KFKNENVGVKVLDSVNITLGAEDELKDAVGLVRPVSVAFEVITGFRLYKSGVYTSDHCGT
TPMDVNHAVLAVGYGVEDGVPYWLIKNSWGADWGDEGYFKMEMGKNMCGVATCASYPIVA
*

MSWEEFRATRLGAAQNCSATLAGNHQMRAAAAAAMPETKDWREDGIVSPVKNQGHCGSCW
TFSTTGALEAAYTQATGKAISLSEQQLVDCGFAFNNFGCKGGLPSQAFEYIKYNGGLDTE
ESYPYQGVNGICQFKAENVGVKVLDSVNITLGAEDELKDAVGLVRPVSVAFEVISGFRLY
KTGVYTSDHCGTTPMDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDEGYFKMEMGKNMC
GVATCASYPVVA*

Other information
Ka divergence:0.216127KaKs divergence:-0.0309623
GC content 1 (%):58GC content 2 (%):55GC content divergence:-0.027
Length 1 (bp):1083Length 2 (bp):759Length divergence:-0.176
MFE 1 (kcal):-433.96MFE 2 (kcal):-281.9MFE divergence-0.212