Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G038953-GRMZM2G079257
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100274376

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.5427210356209
Log2 mRNA fold difference:1.9857370881762
Log2 TE fold difference:-0.4326667757004
Sequences
Protein sequence

MVLAQLGGSISRALAQMSNATVIDEKVLNDCLNEISRALLQADVQFKMVRDMQANIKRIV
NLEALAAGTNKRRIMQQAVFTELCNMLDPGKPSFTPKKGKPSVVMFVGLQGSGKTTTCSK
YAYYHQKKGFKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYMESDPVKIAVEGVERFK
KENCDLIIVDTSGRHKQEAALFEEMRQVSEATKPDLVIFVMDSSIGQAAFDQAQAFKQSV
SVGAVIITKMDGHAKGGGALSAVAATKSPVIFIGTGEHIDDFEVFDVKPFVSRLLGMGDW
SGFMDKIHEVIPTDQQPDLLQKLSEGSFSLRLMYEQFQNLLKMGPIGQVFSMLPGFSAEL
MPKGHEKESQAKIKRYMTMMDSMTDAELDSTNPKLMTESRIIRIARGSGRPVRDVMDMLE
EYKRLAKIWGKMKGLKLQKKGDMSALTRNMNVQQMSKALPPQMLKQIGGMGGLQSLMKQM
GSKEMSGMFGGMGG*

MVLAQLGGSISRALAQMSNATVIDEKVLNECLNEISRALLQADVQFKMVRDMQANIKRIV
NLEALAAGTNKRRIMQQAVFTELCTMLDPGKPSFTPKKGKPSVVMFVGLQGSGKTTTCTK
YAYYHQKKGFKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYMESDPVKIAVEGVERFK
KENCDLIIVDTSGRHKQEAALFEEMRQVSEATKPDLVIFVMDSSIGQAAFDQAQAFKQSV
SVGAVIITKMDGHAKGGGALSAVAATKSPVIFIGTGEHIDEFEVFDVKPFVSRLLGMGDW
AGFMDKIHEVVPTDQQPELLQKLSEGSFTLRLMYEQFQNILKMGPIGQVFSMLPGFSAEL
MPKGHEKESQAKIKRYMTMMDSMTDAELDSTNPKLMTESRIIRIARGSGRPVRDVIDMLE
EYKRLAKIWGKMKGLKIPKKGEMSALSRNMNVQHMSKVLPPQMLKQIGGMGGLQSLMKQM
GSKEMSGMFGGMGGER*

Other information
Ka divergence:-0.501854KaKs divergence:-0.498081
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1485Length 2 (bp):1491Length divergence:0.002
MFE 1 (kcal):-497.23MFE 2 (kcal):-495.4MFE divergence-0.002