Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G038982-GRMZM2G175563
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275123
Function (paralog2):hypothetical protein LOC100383170

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.24579791669185
Log2 mRNA fold difference:-0.27149967827744
Log2 TE fold difference:0.51219819206859
Sequences
Protein sequence

MKSLFKSKIRWQHRSNDPASPSGQPQPQPQQALGPPSPSPSSSPSSAAPLSVSTAATSSP
SSPPSAAATPTGAGAAAAAGAGAAGEDYIASEEEFQMQLAMALSASSNSDCVGDLDGEQI
RKAKLISLDRFAAHRDEGHTAESLSRRYWDYNFLDYHEKVIDGFYDIFGSMESSRQGNMP
SLADLQTGIGDLGFEVIVVNRAIDSTLQEMEQVAQCILLDFPVANIALLVQRIAELVTDN
MGGPVKDANDMLTRWLEKSTELRTSLQTSLLPIGCIKIGLSRHRALLFKILADSVGILCK
LVKGSNYTGGDDDDAINIIKMDNEREFLVDLMAAPGALIPADILSWKGNSLNSNRKLGLS
QTAGSSSTVGANMGPSVLPLEPKGDQLPLFSSGDWISESGSGYGAAETAASTQTSSGATS
SVPAGSAFDSSWMLINHDQSDGPSTSAGTSSQQKVVPQNEHPRNLNRLPDLQEIPESKNL
FADLNPFGDTKSKKTSVPFKGPDQRNNELQKRRENIVPNGGRPQQRLVMKNWSPYNDVSN
NKQYNYVEDSFARRNVGNNAASSSSQITQQAARSNLNSGLRNDASYHNYDSIMAGTSATN
ITSTAETGKVPERVLRGDLDKGQTNYRLQDQHVVGQPPQERLPWGNPAEGRVPMNRFQNQ
AKQHMGNIDTKQDHKKLLPDPKKSPLDRFMDTSLPSRNLDVRSQRLDFDDVSECEIPWED
LVIGERIGLGSYGEVYRADWNGTEVAVKKFLDQDFYGDALDEFRSEVRIMRRLRHPNIVL
FMGAVTRPPNLSIVSEYLPRCDVYSFGVILWELATLRMPWSGMNPMQVVGAVGFQDRRLD
IPKEVDPLVARIIFECWQKDPNLRPSFAQLTSALKTVQRLVTPSHQETQSPHPANAGAAC
RLSAPGGGRHSAVCDKDPVVGCASSPSVQASTFVGPLGRCTVGPWQTNPEPHSFSAPRKT
RIRHLPTMRPPDHRPRAPTAEIQRSIAFPSAALLCSLVLLLSMAAYAGILVPPLPVRLSV
SHLRSVTPASYSLNHRPPRPAVARAASRGNGNGGPPVEGEKERRRSSLPALSEIRLGELL
SPDPANAVAVVLTGALVWAGASLLLQLTLISAAIFAAAVKYSFVAALLLIVLIALL*

MKSLFKSKIRWQHRSNDPASPAAPPPQTSGPPPASSPSGTAPAPALSVSTPVSPSPSSAA
ATPTGAAAAAAAAGAGGEDYISSEEEFQMQLAMALSASSNSDCAGGLDGEQIRKAKLMSL
DRFAAHRDETHTAEFLSRRYWDYNFLDYHEKVIDGFYDIFGSSIESSRQGKMPSLADLQT
GIGDLGFEVIVVNRAIDSTLQEMEQVAQCILLDFPVANIALLVQRIAELVTDNMGGPVKD
ANDMLTRWLEKSTELRTSLQTSLLPIGCIKIGLSRHRALLFKILADSVGIPCKLVKGSNY
TGGDDDDAINIIKMDNEREFLVDLMAAPGALIPADILSWKGNSLNSNRKLGLNRTAGSSS
TVDANVDPTVLPLEPKGGQLPLFSSGDWMSDIDSGYEAAEIAASTQTSSGVTPSVSAGSV
FGSSWMLVNHDQSDGPSTSAGTSSQQKVVPQSEHQRNLNRLPDLQEIPESKYLFADLVPS
GDNKSKKTSVPFKGPDHRNNELQKRRENIVPNAGRPQQRLVMKNWSPYNDVSNNKQYNYV
EDSFARRNVGNNAASSSSQMPRPAVRSNLNSGLHNDASYHNYDSIMAGTSAMKITSTAET
GKVPERVLRGDLDKGQTNYRLEDQHVIVQPPQGRLPWGNPAEGRVPMNRVQSQAKQHLEN
MDAKQDHKKLLPDPKKSPLDRFMDTSLPSRNMDMRSQRLDFDDVSECEIPWEDLVIGERI
GLGSYGEVYRADWNGTEVAVKKFLDQDFYGDALDEFRSEVRIMRRLRHPNIVLFMGAVTR
PPNLSIVSEYLPRGSLYKILHRPNCLIDEKRRIKMALDVAKGMNCLHTSMPTIVHRDLKS
PNLLVDNNWNVKVCDFGLSRLKHSTFLSSKSTAGTPEWMAPEVLRNEQSNEK*

Other information
Ka divergence:0.0858521KaKs divergence:0.102637
GC content 1 (%):51GC content 2 (%):47GC content divergence:-0.041
Length 1 (bp):3411Length 2 (bp):2679Length divergence:-0.12
MFE 1 (kcal):-1228.27MFE 2 (kcal):-907.33MFE divergence-0.15