Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G039525-GRMZM2G340933
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100191567
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.048038392304525
Log2 mRNA fold difference:-0.79887880157432
Log2 TE fold difference:0.75097722034825
Sequences
Protein sequence

MGASSTCPCHHFSSSSILTKRAIAFVLYALVPLALIHYLLSLPPRLPSPPTTGAATSPSR
PQQAEEAPAARCDYSDGEWVRAAAGPRYNGSSCGETIKAGQNCEAHGRPDTGYIYWRWRP
RGCALPPFDPEEFLSAVRGRHVAFVGDSLARNQCESLVCLLASAFPAQLVRGAGGGDGDG
DGDELRKFRRWAFPSHNATVSVFWSPFLVNGTERPKSPAAAGGLDHNRIYFDQPDERWAA
AVPGFDVVVLSAGQWYLNSAMFYDRGAVIGCHRCPEPNRTETGFFGVFRLAVRNALREVI
SRVAATSSPARPRLAVVTTFSPAHFQGDWDSPTACVRTQPYARGEREMEYMDLEMLRAGV
EEVAAAGADASERGAGLAVEALQVTRLAAMRPDGHPGLYTRAFPFAEGAKDRMPNDCVHW
CLPGPIDTWNEILLQLVKGWAVGVGAIADTSSPSP*

MGASTPRHHPSSPFQRSLLSKRIITLALYALVPLALLHYLLSFPPIPAPTTSSPPPPKVA
AAAGGAARKIAAPRCDYSDGAWERSEAGPLYNGTSCGETIKAAQNCEAHGRPDTGYLRWR
WRWRPRGCALPPFDPAEFLRLVRGRHVAFVGDSLARNQCESLVCLLSSAFPAQLVRGAGG
GDGDGDGDELRKFRRWVFPSHNATVSVFWSPFLVNGTEKAKGAAVGLDHNRLYLDQPNER
WAAEVPGIDVVVLSAGHWFLHSALFYDRGAVVGCHHCPEPNRTETGFFGAFRLAVRGALR
EVVLRGARARRQGRRPKLAVLTTFSPAHFEGDWDSPTACARTVPYAPGERAMEYMDGEML
RAEAEEAAAAAADARARRAGVTVETLQVTRMAGLRADGHPGAYMHPFPFAGGARERVPND
CVHWCLPGPIDTWNEILLQLVKRWADGVDADALSSSSP*

Other information
Ka divergence:-0.291726KaKs divergence:-0.313214
GC content 1 (%):71GC content 2 (%):73GC content divergence:0.014
Length 1 (bp):1368Length 2 (bp):1377Length divergence:0.003
MFE 1 (kcal):-734.5MFE 2 (kcal):-744.71MFE divergence0.007