Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G039532-GRMZM2G101264
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100275576

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.29694061381907
Log2 mRNA fold difference:-0.29136038107769
Log2 TE fold difference:0.66596219423914
Sequences
Protein sequence

MDTVREEAWPMAAPQQRRRQPSAPQQQHQNGRIDLRDLKAQMLKRLGPDRSRRYFGYLNG
YLSERLSRQDFEKLCLQTLGQENLQLHNRLIRAILYNAYQGKCPPPPLDAGRPVGSSVKK
ASQAAEVLNTCNSDAKLLQVQGLRSVATAQDHTLKDSMNNMGPKCRVAAVNHNQVTHGAS
GSLENGTINPIELKRLHFQQCEPVEPPAKHPRVEQLPPNNMLLQRSMSSTAERSAEILRS
PVRAPLGIPFCSASVGGARKFPPPPIVTGEDHFNSCFEDGGLFSTELLHRRMEKTAETLG
LAGVTMHSAELLNIALDEYMKNLIRSSVELVGGSVQRDARKGTLPHKNQVYGNRINGVWL
PNHVHMQSGSGSSGTTNEIGSNQLISVSDFKVAMQLNPQHLGENWPVLLEKICLCSSEEN
D*

MDTVREEAWPVAAPRQQPSAPQPQQQQQNGRIDLRELKAQMEKQLGPDRSRRYFGYLNGY
LSERLGRQDFEKLCLHTLGRENLQLHNRLIRAILYNAYQGKCPPPPLDAGRPVGASVKKA
YQAAEVLNACNGDARLLQIQRLRPVARAQDHTLKDSTNNTGPNCRVAAANHNQVTHDASG
SLENGTLNQLELKRLRFQQCEPVEPVAKHPRVEQLPPNNLPVQRRSMSSTAEQSAEILRS
PVRAPLGIPFCSASVGGARKFPPPLIVAGEDHFNSCSEHDGLFSTELLHRRMEKTAETLG
LAGITMDSAELLNIALDKYMKNLIRSSVELVGGSVQRDARKGTPTYKQQAYGKQINGVRL
PNHVHMQSASGSPGAKNEIGINHLISINDFKVAMQLNPQHLGENWPVLLEKICLCSSEEN
D*

Other information
Ka divergence:-0.104785KaKs divergence:-0.14176
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1266Length 2 (bp):1266Length divergence:0
MFE 1 (kcal):-435.26MFE 2 (kcal):-448.64MFE divergence0.015