Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G039725-GRMZM2G057262
Species:maize
Duplication type:WGD
Function (paralog1):S-ribonuclease binding protein SBP1
Function (paralog2):S-ribonuclease binding protein SBP1 (LOC100281816), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.2588655198731
Log2 mRNA fold difference:-3.5355609123136
Log2 TE fold difference:1.3020921355863
Sequences
Protein sequence

MAVQAQYPSNLLFHDRGEPDRKKAMDMPKPPQLAGVSPAAVYFSGGGASGNNRRKRAREA
MAPPPAVKEDYVNLFALQQQQQQQQQQSMPFANMALFQNQNRVSSSPSPAATALVSTGLR
LAFDEQQQHLLQQQESKQTNALRYSSPPSLFASVSDELAAQAKQHEEEVDRFVREQGEQL
RRAVADRLRRHNRAILVKADQSAARRLREKAAEAEREARRGAELEERLARLRGEAAAWQA
KALSEQAAAVALHAQLQQAAAAARASVEELTAAAAAGDAGPAESSASAFVDPRRAGPPPD
HACLACRLRPASVVLLPCRHLSLCGECFAAGDADAAMPCPVCLCVRTGSVEAILC*

MAVQAQYPSDLLFHARGEPERRKEMDMPTPPQLAGVSPAAVYFSGGGASGKSRRKRPREE
CVSLFTVQPQQSTAFASVALFQTQNMVSSSPSPAATALVSTGLRLAFDEQQQQQESKQTD
AFGYPSSPSQSGSVSDELAAQVKRHDEEIDRFVREQVPSPFPCTTRLLSHRPPILTRRTV
PGGVRSWSLTQGEQLRRAVADRLRRHSRAILAKAERSAAARLREKASEAEREARRGAELE
ERLARLRGEAGAWQAKALSEQAAAATLHAQLQQQAAARASAEEQLAAGGGDAGAAQSSSS
AYVDPRRSDRACLGCRLRPASVVLIPCRHLPLCGECFAAGDADAAMACPVCLCVRTGSVE
AILC*

www.000webhost.com

Other information
Ka divergence:0.31547KaKs divergence:-0.3
GC content 1 (%):72GC content 2 (%):72GC content divergence:0
Length 1 (bp):1068Length 2 (bp):1095Length divergence:0.012
MFE 1 (kcal):-579.9MFE 2 (kcal):-585.3MFE divergence0.005