Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G039828-GRMZM2G171912
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192956
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.34923491599941
Log2 mRNA fold difference:-1.3364391789992
Log2 TE fold difference:1.7151937529107
Sequences
Protein sequence

MAAQEQEQEQEKQQAKTSTTSSLPSSSERSSSSARNNLTEGGAESDEEIRRVPEMGGASA
SASSGAGADERPKGEDGKQGQVAAGAQPPAGGKKRGRTAGDKEQNRLKRLLRNRVSAQQA
RERKKAYLTELEAKAKGLELRNAELEQRVSTLQNENNTLRQILKNTTAHASKRSGGGGGG
GGKGGDGGKKHHLAKS*

MAAQEQEHEKQQAKTSTTSSLPSSSERSSSSAPNNLREGAEAAGAGVESDEEIRRVPELG
GASASASASSGAGKEDGARAVAAGAQGHPPAAGKKRGRAPGDKEQNRLKRLLRNRVSAQQ
ARERKKAYLTELEARAKDLELRNAELEQRVSTLQNENNTLRQILKNTTAHASKRSGGGGK
GGDGGKKHHFAKS*

Other information
Ka divergence:0.172309KaKs divergence:0.180392
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):591Length 2 (bp):582Length divergence:-0.008
MFE 1 (kcal):-279.3MFE 2 (kcal):-281.1MFE divergence0.003