Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G039841-GRMZM2G147279
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100275488

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.8865710865296
Log2 mRNA fold difference:-2.8446143614618
Log2 TE fold difference:-0.039833897817725
Sequences
Protein sequence

MACPAQSMLSASGCIFLRSKPQAASQVRGGIIGGGRSSRPFLLTCNASSSPSPSSPAPAQ
EDPDCNEEECAPEKEVGSLSAEWLAEERTQVVGTFPPKKKGWTGLVEKDTAGQTNIYSVE
PMVYVAESAISSGTAGTSAEGAENTAAIAAGLVLITVAAASSILIQVNKSQVPQVPEAAY
SGPPLSYYVTKFQPAVAAPAQTLEAPAPDEAQDGAAATVEAPEVPAPQLSS*

MACPAQSMLSASGCILLRSKPRASSSHVRGGIIGGGCSSRPFQLTCNASSSPSPPSPAPA
QEDPDCNDEECAPEKEVGSLRAEWLAEERTQVVGTFPPRKRGWTGLVEKDTAGQTNIYSV
EPVVYVAESAISSGAAGMSAEGAENTAAIAAGLVLITVAAASSILIQVNKSQPQVPEAAY
NGPPLSYYVAKFQPAQTLEAPAPAEAVEAQDGAATVQDSAAPEAQEAVLIS*

Other information
Ka divergence:0.0793417KaKs divergence:-0.126406
GC content 1 (%):69GC content 2 (%):68GC content divergence:-0.007
Length 1 (bp):696Length 2 (bp):696Length divergence:0
MFE 1 (kcal):-332.6MFE 2 (kcal):-346.22MFE divergence0.02