Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G039867-GRMZM2G060723
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100272726

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.0936036467331
Log2 mRNA fold difference:-1.8484447183037
Log2 TE fold difference:0.75220221669998
Sequences
Protein sequence

MVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLDKHLPIDVVAKIVELRL
KSSMSRRSPFLAHHHPHHHPAAGGMEASSAADIDEHHKIRRMRRALDSSDVELVKLMVMG
EGLNLDEALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVAV
LLDHHADPNVRTVEGVTPLDILRTLTSDFLFKGAVPGLAHVEPNKLRLCLELVQSAAMVM
SREDAHTAVNPAAAPMYGEPSGGGAVYSASGTSSSMVNLSLDNRMVYLNLGMDAQFGKMD
DGGDGDDGGGRGQGGPPSLFSPHGYH*

MEDTLKSLSMDYLNLLINGQAFSDVTFNVEGRLVHAHRCILAARSLFFRKFFCGAEQAAA
GPGALLLDHLSPRSPSGTSSPRGASAAAPGAAVIPVNSVSYEVFLLLLQFLYSGQVSLVP
QKGEPRPGCGERACWHTHCAAAVDLALDTLAAARSFGVEELALLTQKQLAGMVEKASIED
VMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPMDVVSKIDELRLKSSLSRRSP
FLAHHHHPAPGGGMEASSAADIDDHHKIRRMRRALDSSDVELVKLMVMGEGLNLDEALAL
HYAVENCSREVVKALLELGAADVNHTAGPAGKTPLHVAAEMVCPDMVAVLLDHHADPNVR
TVEGVTPLDILRTLTSDLLFKGAVPGLAHIEPNKLRLCLELVQSAAMVMSREDAHTAVNA
APMYGEPSGGGGCGVYSASGTSSTSLVNLNLDNRMVYLNLGMDAQFGKMGDGDDGGGRGP
SSLFSPHGYH*

Other information
Ka divergence:0.208024KaKs divergence:0.312551
GC content 1 (%):69GC content 2 (%):70GC content divergence:0.007
Length 1 (bp):981Length 2 (bp):1473Length divergence:0.2
MFE 1 (kcal):-482.4MFE 2 (kcal):-733.3MFE divergence0.206